|
PY17X_0101900 | PY17X_0101900.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1317 | PY17X_0101900 | lysophospholipase, putative | lysophospholipase, putative | | | 1 | Py17X_01_v3:163,246..164,562(+) | Py17X_01_v3:163246..164562(+) | Py17X_01_v3 | Plasmodium yoelii yoelii 17X | 450 | OG6_100231 | 11 | 438 | 1317 | 50058 | 5.73 | 1 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0101900ORlysophospholipase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0101900 OR lysophospholipase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0104200 | PY17X_0104200.1 | 20 | 20 | 1 | | | reverse | protein coding | No | 5592 | PY17X_0104200 | centrosomal protein CEP76, putative | centrosomal protein CEP76, putative | | | 1 | Py17X_01_v3:244,658..252,753(-) | Py17X_01_v3:244658..252753(-) | Py17X_01_v3 | Plasmodium yoelii yoelii 17X | 46 | OG6_126374 | 0 | 1863 | 5592 | 222144 | 6.84 | 0 | | | | | | | | | | | | | | | | 1.3.-.- (Acting on the CH-CH group of donors.) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0104200ORcentrosomal protein CEP76, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0104200 OR centrosomal protein CEP76, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0108700 | PY17X_0108700.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 708 | PY17X_0108700 | proteasome subunit alpha type-2, putative | proteasome subunit alpha type-2, putative | | | 1 | Py17X_01_v3:421,618..422,579(-) | Py17X_01_v3:421618..422579(-) | Py17X_01_v3 | Plasmodium yoelii yoelii 17X | 43 | OG6_101969 | 0 | 235 | 708 | 26402 | 4.86 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0108700ORproteasome subunit alpha type-2, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0108700 OR proteasome subunit alpha type-2, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0115700 | PY17X_0115700.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1260 | PY17X_0115700 | lysophospholipase, putative | lysophospholipase, putative | | | 1 | Py17X_01_v3:697,458..698,717(-) | Py17X_01_v3:697458..698717(-) | Py17X_01_v3 | Plasmodium yoelii yoelii 17X | 450 | OG6_100231 | 11 | 419 | 1260 | 48199 | 8.90 | 1 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0115700ORlysophospholipase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0115700 OR lysophospholipase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0202600 | PY17X_0202600.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1398 | PY17X_0202600 | lysophospholipase, putative | lysophospholipase, putative | | | 2 | Py17X_02_v3:198,102..199,499(+) | Py17X_02_v3:198102..199499(+) | Py17X_02_v3 | Plasmodium yoelii yoelii 17X | 450 | OG6_100231 | 11 | 465 | 1398 | 53118 | 5.60 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0202600ORlysophospholipase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0202600 OR lysophospholipase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0206800 | PY17X_0206800.1 | 4 | 4 | 1 | | | forward | protein coding | No | 657 | PY17X_0206800 | proteasome subunit beta type-3, putative | proteasome subunit beta type-3, putative | | | 2 | Py17X_02_v3:326,429..327,520(+) | Py17X_02_v3:326429..327520(+) | Py17X_02_v3 | Plasmodium yoelii yoelii 17X | 45 | OG6_101970 | 0 | 218 | 657 | 24533 | 4.70 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0019774 | proteasome core complex, beta-subunit complex | | | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0206800ORproteasome subunit beta type-3, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0206800 OR proteasome subunit beta type-3, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0210200 | PY17X_0210200.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 9021 | PY17X_0210200 | ubiquitin carboxyl-terminal hydrolase 1, putative | ubiquitin carboxyl-terminal hydrolase 1, putative | | | 2 | Py17X_02_v3:444,848..454,207(-) | Py17X_02_v3:444848..454207(-) | Py17X_02_v3 | Plasmodium yoelii yoelii 17X | 38 | OG6_129339 | 0 | 3006 | 9021 | 354212 | 8.27 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0210200ORubiquitin carboxyl-terminal hydrolase 1, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0210200 OR ubiquitin carboxyl-terminal hydrolase 1, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0211100 | PY17X_0211100.1 | 1 | 1 | 1 | | | forward | protein coding | No | 4821 | PY17X_0211100 | zinc-carboxypeptidase, putative | zinc-carboxypeptidase, putative | | | 2 | Py17X_02_v3:488,208..493,028(+) | Py17X_02_v3:488208..493028(+) | Py17X_02_v3 | Plasmodium yoelii yoelii 17X | 36 | OG6_101273 | 0 | 1606 | 4821 | 186702 | 9.77 | 0 | | | | | | | | | | | | | | | | 3.4.17.10 (Carboxypeptidase E) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0211100ORzinc-carboxypeptidase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0211100 OR zinc-carboxypeptidase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0212000 | PY17X_0212000.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 8562 | PY17X_0212000 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | | 2 | Py17X_02_v3:532,908..542,106(-) | Py17X_02_v3:532908..542106(-) | Py17X_02_v3 | Plasmodium yoelii yoelii 17X | 46 | OG6_101317 | 0 | 2853 | 8562 | 332926 | 8.55 | 0 | | | | | GO:0005515;GO:0036459 | protein binding;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0212000ORubiquitin carboxyl-terminal hydrolase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0212000 OR ubiquitin carboxyl-terminal hydrolase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0212900 | PY17X_0212900.1 | 3 | 3 | 1 | | | forward | protein coding | No | 771 | PY17X_0212900 | proteasome subunit alpha type-5, putative | proteasome subunit alpha type-5, putative | | | 2 | Py17X_02_v3:565,639..566,779(+) | Py17X_02_v3:565639..566779(+) | Py17X_02_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_101621 | 0 | 256 | 771 | 28362 | 4.79 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0212900ORproteasome subunit alpha type-5, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0212900 OR proteasome subunit alpha type-5, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0214200 | PY17X_0214200.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 1686 | PY17X_0214200 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | | | 2 | Py17X_02_v3:627,033..629,570(-) | Py17X_02_v3:627033..629570(-) | Py17X_02_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_110414 | 0 | 561 | 1686 | 65613 | 8.95 | 0 | | | | | | | | | | | GO:0016298 | lipase activity | GO:0006629 | lipid metabolic process | | 3.-.-.- (Hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0214200ORalpha/beta hydrolase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0214200 OR alpha/beta hydrolase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0305300 | PY17X_0305300.1 | 6 | 6 | 1 | | | reverse | protein coding | No | 2136 | PY17X_0305300 | serine repeat antigen 5 | serine repeat antigen 5 | | | 3 | Py17X_03_v3:201,948..205,076(-) | Py17X_03_v3:201948..205076(-) | Py17X_03_v3 | Plasmodium yoelii yoelii 17X | 376 | OG6_126098 | 4 | 711 | 2136 | 82112 | 7.02 | 0 | HMM: MKTYKIKYFLLISFFINLIKQAKSK, NN: MKTYKIKYFLLISFFINLIKQAKSK | NN Sum: 4, NN D: .69, HMM Prob: .41 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0305300ORserine repeat antigen 5ANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0305300 OR serine repeat antigen 5 AND Plasmodium yoelii yoelii 17X |
|
PY17X_0305400 | PY17X_0305400.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 2748 | PY17X_0305400 | serine repeat antigen 4 | serine repeat antigen 4 | | | 3 | Py17X_03_v3:206,707..209,880(-) | Py17X_03_v3:206707..209880(-) | Py17X_03_v3 | Plasmodium yoelii yoelii 17X | 376 | OG6_126098 | 4 | 915 | 2748 | 105614 | 4.93 | 0 | NN: MNPRRYLLLVSCAIFTINVHEIKTQ, HMM: MNPRRYLLLVSCAIFTINVHEIKTQ | NN Sum: 2, NN D: .42, HMM Prob: .73 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0305400ORserine repeat antigen 4ANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0305400 OR serine repeat antigen 4 AND Plasmodium yoelii yoelii 17X |
|
PY17X_0305500 | PY17X_0305500.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 3621 | PY17X_0305500 | serine repeat antigen 3 | serine repeat antigen 3 | | | 3 | Py17X_03_v3:210,991..214,990(-) | Py17X_03_v3:210991..214990(-) | Py17X_03_v3 | Plasmodium yoelii yoelii 17X | 376 | OG6_126098 | 4 | 1206 | 3621 | 133888 | 4.85 | 0 | HMM: MARLSSIVFIICLLLCNNAISN, NN: MARLSSIVFIICLLLCNNAI | NN Sum: 4, NN D: .82, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0005737;GO:0030430 | cytoplasm;host cell cytoplasm | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0305500ORserine repeat antigen 3ANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0305500 OR serine repeat antigen 3 AND Plasmodium yoelii yoelii 17X |
|
PY17X_0305600 | PY17X_0305600.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 3438 | PY17X_0305600 | serine repeat antigen 2 | serine repeat antigen 2 | | | 3 | Py17X_03_v3:216,412..220,318(-) | Py17X_03_v3:216412..220318(-) | Py17X_03_v3 | Plasmodium yoelii yoelii 17X | 376 | OG6_126098 | 4 | 1145 | 3438 | 125285 | 4.89 | 0 | HMM: MKTYIPLIFLLYAMLGNDIINCR, NN: MKTYIPLIFLLYAMLGNDIINCR | NN Sum: 4, NN D: .61, HMM Prob: .86 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0305600ORserine repeat antigen 2ANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0305600 OR serine repeat antigen 2 AND Plasmodium yoelii yoelii 17X |
|
PY17X_0305700 | PY17X_0305700.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 4485 | PY17X_0305700 | serine repeat antigen 1 | serine repeat antigen 1 | | | 3 | Py17X_03_v3:221,899..226,818(-) | Py17X_03_v3:221899..226818(-) | Py17X_03_v3 | Plasmodium yoelii yoelii 17X | 376 | OG6_126098 | 4 | 1494 | 4485 | 163888 | 4.42 | 0 | NN: MRRLPILFILYALLIRNSKEGGLGV, HMM: MRRLPILFILYALLIRNSK | NN Sum: 4, NN D: .58, HMM Prob: .95 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0305700ORserine repeat antigen 1ANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0305700 OR serine repeat antigen 1 AND Plasmodium yoelii yoelii 17X |
|
PY17X_0312100 | PY17X_0312100.1 | 2 | 2 | 1 | | | forward | protein coding | No | 3732 | PY17X_0312100 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | | | 3 | Py17X_03_v3:464,968..468,878(+) | Py17X_03_v3:464968..468878(+) | Py17X_03_v3 | Plasmodium yoelii yoelii 17X | 1 | OG6r1_163159 | 0 | 1243 | 3732 | 146100 | 8.51 | 12 | | | | | | | | | GO:0016021 | integral component of membrane | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0312100ORconserved Plasmodium protein, unknown functionANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0312100 OR conserved Plasmodium protein, unknown function AND Plasmodium yoelii yoelii 17X |
|
PY17X_0318100 | PY17X_0318100.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1377 | PY17X_0318100 | lysophospholipase, putative | lysophospholipase, putative | | | 3 | Py17X_03_v3:681,295..682,671(-) | Py17X_03_v3:681295..682671(-) | Py17X_03_v3 | Plasmodium yoelii yoelii 17X | 450 | OG6_100231 | 11 | 458 | 1377 | 52743 | 6.58 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0318100ORlysophospholipase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0318100 OR lysophospholipase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0408000 | PY17X_0408000.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1014 | PY17X_0408000 | ATP-dependent Clp protease proteolytic subunit, putative | ATP-dependent Clp protease proteolytic subunit, putative | | | 4 | Py17X_04_v3:408,618..409,631(-) | Py17X_04_v3:408618..409631(-) | Py17X_04_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_100939 | 0 | 337 | 1014 | 39460 | 9.67 | 0 | NN: MIYLILFTFLILIKNNTIEAK, HMM: MIYLILFTFLILIKNNTIEAK | NN Sum: 4, NN D: .74, HMM Prob: .7 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0408000ORATP-dependent Clp protease proteolytic subunit, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0408000 OR ATP-dependent Clp protease proteolytic subunit, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0412200 | PY17X_0412200.1 | 15 | 15 | 1 | | | forward | protein coding | No | 1326 | PY17X_0412200 | plasmepsin VI, putative | plasmepsin VI, putative | | | 4 | Py17X_04_v3:569,905..573,134(+) | Py17X_04_v3:569905..573134(+) | Py17X_04_v3 | Plasmodium yoelii yoelii 17X | 158 | OG6_100536 | 1 | 441 | 1326 | 50393 | 7.52 | 1 | HMM: MPNFRIKSYLFLYLSFLLFFEIITI, NN: MPNFRIKSYLFLYLSFLLFFEIITIFHVSSI | NN Sum: 4, NN D: .76, HMM Prob: .27 | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0412200ORplasmepsin VI, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0412200 OR plasmepsin VI, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0414800 | PY17X_0414800.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3933 | PY17X_0414800 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | | | 4 | Py17X_04_v3:636,511..640,443(-) | Py17X_04_v3:636511..640443(-) | Py17X_04_v3 | Plasmodium yoelii yoelii 17X | 42 | OG6_533302 | 0 | 1310 | 3933 | 157576 | 9.75 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0414800ORconserved Plasmodium protein, unknown functionANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0414800 OR conserved Plasmodium protein, unknown function AND Plasmodium yoelii yoelii 17X |
|
PY17X_0414900 | PY17X_0414900.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1137 | PY17X_0414900 | DER1-like protein, putative | DER1-like protein, putative | | | 4 | Py17X_04_v3:640,696..641,832(-) | Py17X_04_v3:640696..641832(-) | Py17X_04_v3 | Plasmodium yoelii yoelii 17X | 87 | OG6_130104 | 1 | 378 | 1137 | 45899 | 9.72 | 3 | NN: MLVSKFLFFLSLIASVRYY, HMM: MLVSKFLFFLSLIASVRYYYYCDAK | NN Sum: 4, NN D: .82, HMM Prob: .93 | | | | | | | GO:0020011 | apicoplast | | | GO:0030433 | ubiquitin-dependent ERAD pathway | | | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0414900ORDER1-like protein, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0414900 OR DER1-like protein, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0419600 | PY17X_0419600.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 4263 | PY17X_0419600 | ubiquitin specific protease, putative | ubiquitin specific protease, putative | | | 4 | Py17X_04_v3:845,416..849,865(-) | Py17X_04_v3:845416..849865(-) | Py17X_04_v3 | Plasmodium yoelii yoelii 17X | 35 | OG6_122792 | 0 | 1420 | 4263 | 164945 | 8.41 | 0 | | | | | GO:0004843;GO:0036459 | thiol-dependent ubiquitin-specific protease activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0419600ORubiquitin specific protease, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0419600 OR ubiquitin specific protease, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0419800 | PY17X_0419800.1 | 1 | 1 | 1 | | | forward | protein coding | No | 558 | PY17X_0419800 | signal peptidase complex subunit 3, putative | signal peptidase complex subunit 3, putative | | | 4 | Py17X_04_v3:854,017..854,574(+) | Py17X_04_v3:854017..854574(+) | Py17X_04_v3 | Plasmodium yoelii yoelii 17X | 43 | OG6_102447 | 0 | 185 | 558 | 21876 | 8.85 | 1 | HMM: MDSLLNRINVIFYSMALCFITLCLFNYGTSF, NN: MDSLLNRINVIFYSMALCFITLCLFNYGTSF | NN Sum: 4, NN D: .7, HMM Prob: .08 | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | 3.4.21.89 (Signal peptidase I) | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0419800ORsignal peptidase complex subunit 3, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0419800 OR signal peptidase complex subunit 3, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0502500 | PY17X_0502500.1 | 2 | 2 | 1 | | | forward | protein coding | No | 1593 | PY17X_0502500 | enoyl-CoA hydratase-related protein, putative | enoyl-CoA hydratase-related protein, putative | | | 5 | Py17X_05_v3:224,464..226,296(+) | Py17X_05_v3:224464..226296(+) | Py17X_05_v3 | Plasmodium yoelii yoelii 17X | 43 | OG6_134153 | 0 | 530 | 1593 | 62360 | 8.68 | 0 | | | | | GO:0003860 | 3-hydroxyisobutyryl-CoA hydrolase activity | | | | | | | | | | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0502500ORenoyl-CoA hydratase-related protein, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0502500 OR enoyl-CoA hydratase-related protein, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0503600 | PY17X_0503600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2361 | PY17X_0503600 | peptidase, putative | peptidase, putative | | | 5 | Py17X_05_v3:260,546..262,906(-) | Py17X_05_v3:260546..262906(-) | Py17X_05_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_124535 | 0 | 786 | 2361 | 89330 | 5.03 | 2 | HMM: MEIKNTICKRFNLFLISIVVLICTFGL, NN: MEIKNTICKRFNLFLISIVVLICTFGL | NN Sum: 4, NN D: .65, HMM Prob: .04 | | | | | | | | | | | | | | 3.1.3.16 (Protein-serine/threonine phosphatase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0503600ORpeptidase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0503600 OR peptidase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0505200 | PY17X_0505200.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 375 | PY17X_0505200 | autophagy-related protein 8, putative | autophagy-related protein 8, putative | | | 5 | Py17X_05_v3:333,027..333,401(-) | Py17X_05_v3:333027..333401(-) | Py17X_05_v3 | Plasmodium yoelii yoelii 17X | 45 | OG6_100707 | 0 | 124 | 375 | 14685 | 8.06 | 0 | | | | | | | | | GO:0020011;GO:0031410 | apicoplast;cytoplasmic vesicle | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0505200ORautophagy-related protein 8, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0505200 OR autophagy-related protein 8, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0515600 | PY17X_0515600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1806 | PY17X_0515600 | tRNA N6-adenosine threonylcarbamoyltransferase, putative | tRNA N6-adenosine threonylcarbamoyltransferase, putative | | | 5 | Py17X_05_v3:735,040..736,845(-) | Py17X_05_v3:735040..736845(-) | Py17X_05_v3 | Plasmodium yoelii yoelii 17X | 88 | OG6_100288 | 1 | 601 | 1806 | 68326 | 8.44 | 1 | | | | | | | | | | | | | | | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0515600ORtRNA N6-adenosine threonylcarbamoyltransferase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0515600 OR tRNA N6-adenosine threonylcarbamoyltransferase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0516400 | PY17X_0516400.1 | 8 | 8 | 1 | | | forward | protein coding | No | 957 | PY17X_0516400 | OTU-like cysteine protease, putative | OTU-like cysteine protease, putative | | | 5 | Py17X_05_v3:752,520..754,451(+) | Py17X_05_v3:752520..754451(+) | Py17X_05_v3 | Plasmodium yoelii yoelii 17X | 45 | OG6_104209 | 0 | 318 | 957 | 37892 | 4.71 | 0 | | | | | | | | | GO:0020011;GO:0005829;GO:0031982 | apicoplast;cytosol;vesicle | GO:0008233 | peptidase activity | GO:1903060 | negative regulation of protein lipidation | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0516400OROTU-like cysteine protease, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0516400 OR OTU-like cysteine protease, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0517400 | PY17X_0517400.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 786 | PY17X_0517400 | DER1-like protein, putative | DER1-like protein, putative | | | 5 | Py17X_05_v3:786,601..787,763(-) | Py17X_05_v3:786601..787763(-) | Py17X_05_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_113960 | 0 | 261 | 786 | 30763 | 9.74 | 5 | HMM: MDLSGPEVWYNNLPNVTKYMIIIIFLVTLLITCNLL, NN: MDLSGPEVWYNNLPNVTKYMIIIIFLVTLLITCNLL | NN Sum: 3, NN D: .48, HMM Prob: .01 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0517400ORDER1-like protein, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0517400 OR DER1-like protein, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0518700 | PY17X_0518700.1 | 8 | 8 | 1 | | | forward | protein coding | No | 1419 | PY17X_0518700 | plasmepsin VII, putative | plasmepsin VII, putative | | | 5 | Py17X_05_v3:827,588..829,944(+) | Py17X_05_v3:827588..829944(+) | Py17X_05_v3 | Plasmodium yoelii yoelii 17X | 46 | OG6_139465 | 0 | 472 | 1419 | 54419 | 8.85 | 1 | NN: MKSVYHHFAIIFFLKLFLCNCILAI, HMM: MKSVYHHFAIIFFLKLFLCNCILAI | NN Sum: 4, NN D: .82, HMM Prob: .96 | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0518700ORplasmepsin VII, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0518700 OR plasmepsin VII, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0607100 | PY17X_0607100.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3591 | PY17X_0607100 | conserved protein, unknown function | conserved protein, unknown function | | | 6 | Py17X_06_v3:376,419..380,009(-) | Py17X_06_v3:376419..380009(-) | Py17X_06_v3 | Plasmodium yoelii yoelii 17X | 43 | OG6_102131 | 0 | 1196 | 3591 | 136025 | 5.18 | 2 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0607100ORconserved protein, unknown functionANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0607100 OR conserved protein, unknown function AND Plasmodium yoelii yoelii 17X |
|
PY17X_0614500 | PY17X_0614500.1 | 1 | 1 | 1 | | | forward | protein coding | No | 723 | PY17X_0614500 | ATP-dependent Clp protease proteolytic subunit, putative | ATP-dependent Clp protease proteolytic subunit, putative | | | 6 | Py17X_06_v3:666,510..667,232(+) | Py17X_06_v3:666510..667232(+) | Py17X_06_v3 | Plasmodium yoelii yoelii 17X | 42 | OG6_113660 | 0 | 240 | 723 | 28033 | 9.40 | 0 | NN: MHSFWIFIINFIYFCVCK, HMM: MHSFWIFIINFIYFCVCK | NN Sum: 4, NN D: .62, HMM Prob: .07 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0020011 | apicoplast | | | | | 3.4.21.92 (Endopeptidase Clp) | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0614500ORATP-dependent Clp protease proteolytic subunit, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0614500 OR ATP-dependent Clp protease proteolytic subunit, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0614600 | PY17X_0614600.1 | 2 | 2 | 1 | | | forward | protein coding | No | 2607 | PY17X_0614600 | conserved protein, unknown function | conserved protein, unknown function | | | 6 | Py17X_06_v3:667,546..670,293(+) | Py17X_06_v3:667546..670293(+) | Py17X_06_v3 | Plasmodium yoelii yoelii 17X | 45 | OG6_146174 | 0 | 868 | 2607 | 104073 | 9.26 | 0 | | | | | | | | | | | | | | | | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0614600ORconserved protein, unknown functionANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0614600 OR conserved protein, unknown function AND Plasmodium yoelii yoelii 17X |
|
PY17X_0619000 | PY17X_0619000.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1389 | PY17X_0619000 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | | | 6 | Py17X_06_v3:853,714..855,102(-) | Py17X_06_v3:853714..855102(-) | Py17X_06_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_533066 | 0 | 462 | 1389 | 53583 | 9.12 | 6 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0619000ORconserved Plasmodium protein, unknown functionANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0619000 OR conserved Plasmodium protein, unknown function AND Plasmodium yoelii yoelii 17X |
|
PY17X_0622500 | PY17X_0622500.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2958 | PY17X_0622500 | zinc finger protein, putative | zinc finger protein, putative | | | 6 | Py17X_06_v3:960,627..963,584(-) | Py17X_06_v3:960627..963584(-) | Py17X_06_v3 | Plasmodium yoelii yoelii 17X | 43 | OG6_532410 | 0 | 985 | 2958 | 118050 | 8.21 | 0 | | | | | GO:0008270 | zinc ion binding | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0622500ORzinc finger protein, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0622500 OR zinc finger protein, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0626200 | PY17X_0626200.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1596 | PY17X_0626200 | lysophospholipase, putative | lysophospholipase, putative | | | 6 | Py17X_06_v3:1,107,857..1,109,452(+) | Py17X_06_v3:1107857..1109452(+) | Py17X_06_v3 | Plasmodium yoelii yoelii 17X | 450 | OG6_100231 | 11 | 531 | 1596 | 59524 | 4.43 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0626200ORlysophospholipase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0626200 OR lysophospholipase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0703000 | PY17X_0703000.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 801 | PY17X_0703000 | rhomboid protease ROM3, putative | rhomboid protease ROM3, putative | | | 7 | Py17X_07_v3:297,849..299,182(-) | Py17X_07_v3:297849..299182(-) | Py17X_07_v3 | Plasmodium yoelii yoelii 17X | 93 | OG6_100562 | 1 | 266 | 801 | 30494 | 7.60 | 7 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | 3.4.21.105 (Rhomboid protease) | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0703000ORrhomboid protease ROM3, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0703000 OR rhomboid protease ROM3, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0704600 | PY17X_0704600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1125 | PY17X_0704600 | SPRY domain, putative | SPRY domain, putative | | | 7 | Py17X_07_v3:356,885..358,009(-) | Py17X_07_v3:356885..358009(-) | Py17X_07_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_102272 | 0 | 374 | 1125 | 43634 | 8.74 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0704600ORSPRY domain, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0704600 OR SPRY domain, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0704700 | PY17X_0704700.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1323 | PY17X_0704700 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | | | 7 | Py17X_07_v3:360,020..361,342(+) | Py17X_07_v3:360020..361342(+) | Py17X_07_v3 | Plasmodium yoelii yoelii 17X | 67 | OG6_129556 | 0 | 440 | 1323 | 51649 | 9.95 | 0 | | | | | | | | | | | | | | | | 3.4.11.- (Aminopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0704700ORalpha/beta hydrolase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0704700 OR alpha/beta hydrolase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0707500 | PY17X_0707500.1 | 5 | 5 | 1 | | | reverse | protein coding | No | 1506 | PY17X_0707500 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | | | 7 | Py17X_07_v3:460,100..462,180(-) | Py17X_07_v3:460100..462180(-) | Py17X_07_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_105308 | 0 | 501 | 1506 | 58703 | 8.63 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0707500ORalpha/beta hydrolase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0707500 OR alpha/beta hydrolase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0712400 | PY17X_0712400.1 | 11 | 11 | 1 | | | forward | protein coding | No | 864 | PY17X_0712400 | BEM46-like protein | BEM46-like protein | | | 7 | Py17X_07_v3:634,880..637,132(+) | Py17X_07_v3:634880..637132(+) | Py17X_07_v3 | Plasmodium yoelii yoelii 17X | 45 | OG6_101827 | 0 | 287 | 864 | 32764 | 8.94 | 1 | NN: MVLKKVIISIIIAIIASLVFINTY, HMM: MVLKKVIISIIIAIIASLVFINTY | NN Sum: 3, NN D: .66, HMM Prob: .15 | | | | | | | GO:0005886 | plasma membrane | GO:0016298 | lipase activity | GO:0048469;GO:0030260;GO:0006629 | cell maturation;entry into host cell;lipid metabolic process | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0712400ORBEM46-like proteinANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0712400 OR BEM46-like protein AND Plasmodium yoelii yoelii 17X |
|
PY17X_0714400 | PY17X_0714400.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3147 | PY17X_0714400 | chaperone protein ClpB1, putative | chaperone protein ClpB1, putative | | | 7 | Py17X_07_v3:706,825..709,971(+) | Py17X_07_v3:706825..709971(+) | Py17X_07_v3 | Plasmodium yoelii yoelii 17X | 95 | OG6_100223 | 1 | 1048 | 3147 | 119677 | 9.16 | 0 | NN: MQKNFIAFFVIISVSFLCKQGDGK, HMM: MQKNFIAFFVIISVSFLCKQGDGK | NN Sum: 4, NN D: .63, HMM Prob: .79 | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0714400ORchaperone protein ClpB1, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0714400 OR chaperone protein ClpB1, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0715800 | PY17X_0715800.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1188 | PY17X_0715800 | 26S protease regulatory subunit 6B, putative | 26S protease regulatory subunit 6B, putative | | | 7 | Py17X_07_v3:746,186..747,740(-) | Py17X_07_v3:746186..747740(-) | Py17X_07_v3 | Plasmodium yoelii yoelii 17X | 42 | OG6_101965 | 0 | 395 | 1188 | 45177 | 9.45 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0008540 | proteasome regulatory particle, base subcomplex | | | GO:0070682;GO:0006511 | proteasome regulatory particle assembly;ubiquitin-dependent protein catabolic process | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0715800OR26S protease regulatory subunit 6B, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0715800 OR 26S protease regulatory subunit 6B, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0716100 | PY17X_0716100.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 2595 | PY17X_0716100 | ubiquitin carboxyl-terminal hydrolase 13, putative | ubiquitin carboxyl-terminal hydrolase 13, putative | | | 7 | Py17X_07_v3:752,511..755,501(-) | Py17X_07_v3:752511..755501(-) | Py17X_07_v3 | Plasmodium yoelii yoelii 17X | 42 | OG6_101380 | 0 | 864 | 2595 | 99987 | 5.21 | 0 | | | | | GO:0005515;GO:0004843;GO:0036459;GO:0008270 | protein binding;thiol-dependent ubiquitin-specific protease activity;thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | GO:0101005 | ubiquitinyl hydrolase activity | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0716100ORubiquitin carboxyl-terminal hydrolase 13, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0716100 OR ubiquitin carboxyl-terminal hydrolase 13, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0721400 | PY17X_0721400.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 936 | PY17X_0721400 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | | | 7 | Py17X_07_v3:954,466..955,547(-) | Py17X_07_v3:954466..955547(-) | Py17X_07_v3 | Plasmodium yoelii yoelii 17X | 43 | OG6_174320 | 0 | 311 | 936 | 36708 | 9.47 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0721400ORconserved Plasmodium protein, unknown functionANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0721400 OR conserved Plasmodium protein, unknown function AND Plasmodium yoelii yoelii 17X |
|
PY17X_0722200 | PY17X_0722200.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1863 | PY17X_0722200 | lysophospholipase, putative | lysophospholipase, putative | | | 7 | Py17X_07_v3:997,154..999,016(+) | Py17X_07_v3:997154..999016(+) | Py17X_07_v3 | Plasmodium yoelii yoelii 17X | 450 | OG6_100231 | 11 | 620 | 1863 | 69403 | 4.63 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0722200ORlysophospholipase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0722200 OR lysophospholipase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0810600 | PY17X_0810600.1 | 1 | 1 | 1 | | | forward | protein coding | No | 669 | PY17X_0810600 | 26S proteasome non-ATPase regulatory subunit 9, putative | 26S proteasome non-ATPase regulatory subunit 9, putative | | | 8 | Py17X_08_v3:479,027..479,695(+) | Py17X_08_v3:479027..479695(+) | Py17X_08_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_102356 | 0 | 222 | 669 | 25757 | 5.73 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005838 | proteasome regulatory particle | | | GO:0070682 | proteasome regulatory particle assembly | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0810600OR26S proteasome non-ATPase regulatory subunit 9, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0810600 OR 26S proteasome non-ATPase regulatory subunit 9, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0811400 | PY17X_0811400.1 | 2 | 2 | 1 | | | forward | protein coding | No | 753 | PY17X_0811400 | proteasome subunit alpha type-3, putative | proteasome subunit alpha type-3, putative | | | 8 | Py17X_08_v3:529,227..530,105(+) | Py17X_08_v3:529227..530105(+) | Py17X_08_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_102011 | 0 | 250 | 753 | 28665 | 6.62 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0811400ORproteasome subunit alpha type-3, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0811400 OR proteasome subunit alpha type-3, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0812200 | PY17X_0812200.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2286 | PY17X_0812200 | ATP-dependent protease ATPase subunit ClpY, putative | ATP-dependent protease ATPase subunit ClpY, putative | | | 8 | Py17X_08_v3:548,569..550,854(-) | Py17X_08_v3:548569..550854(-) | Py17X_08_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_106348 | 0 | 761 | 2286 | 86826 | 8.88 | 0 | | | GO:0009376;GO:0005737 | HslUV protease complex;cytoplasm | GO:0005524;GO:0016887;GO:0070011 | ATP binding;ATPase activity;peptidase activity, acting on L-amino acid peptides | | | GO:0009376 | HslUV protease complex | | | | | | 2.7.1.71 (Shikimate kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0812200ORATP-dependent protease ATPase subunit ClpY, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0812200 OR ATP-dependent protease ATPase subunit ClpY, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0817200 | PY17X_0817200.1 | 2 | 2 | 1 | | | forward | protein coding | No | 954 | PY17X_0817200 | 26S proteasome regulatory subunit RPN8, putative | 26S proteasome regulatory subunit RPN8, putative | | | 8 | Py17X_08_v3:729,272..730,429(+) | Py17X_08_v3:729272..730429(+) | Py17X_08_v3 | Plasmodium yoelii yoelii 17X | 47 | OG6_102054 | 0 | 317 | 954 | 36535 | 7.04 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.1.3.16 (Protein-serine/threonine phosphatase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0817200OR26S proteasome regulatory subunit RPN8, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0817200 OR 26S proteasome regulatory subunit RPN8, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0817800 | PY17X_0817800.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 1311 | PY17X_0817800 | protease, putative | protease, putative | | | 8 | Py17X_08_v3:743,861..745,495(-) | Py17X_08_v3:743861..745495(-) | Py17X_08_v3 | Plasmodium yoelii yoelii 17X | 43 | OG6_112025 | 0 | 436 | 1311 | 52620 | 9.93 | 9 | NN: MMYRVLIFLYFSIMCYILIEGF, HMM: MMYRVLIFLYFSIMCYILIEGF | NN Sum: 4, NN D: .78, HMM Prob: .45 | GO:0016020 | membrane | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0817800ORprotease, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0817800 OR protease, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0822600 | PY17X_0822600.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 939 | PY17X_0822600 | eukaryotic translation initiation factor 3 subunit F, putative | eukaryotic translation initiation factor 3 subunit F, putative | | | 8 | Py17X_08_v3:901,499..902,574(-) | Py17X_08_v3:901499..902574(-) | Py17X_08_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_103242 | 0 | 312 | 939 | 35891 | 6.75 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005852 | eukaryotic translation initiation factor 3 complex | GO:0003743 | translation initiation factor activity | GO:0006413 | translational initiation | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0822600OReukaryotic translation initiation factor 3 subunit F, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0822600 OR eukaryotic translation initiation factor 3 subunit F, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0823400 | PY17X_0823400.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 732 | PY17X_0823400 | PPPDE peptidase, putative | PPPDE peptidase, putative | | | 8 | Py17X_08_v3:937,339..938,192(-) | Py17X_08_v3:937339..938192(-) | Py17X_08_v3 | Plasmodium yoelii yoelii 17X | 90 | OG6_101256 | 1 | 243 | 732 | 28342 | 9.16 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0823400ORPPPDE peptidase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0823400 OR PPPDE peptidase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0827300 | PY17X_0827300.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 699 | PY17X_0827300 | OTU domain-containing protein, putative | OTU domain-containing protein, putative | | | 8 | Py17X_08_v3:1,077,700..1,078,398(-) | Py17X_08_v3:1077700..1078398(-) | Py17X_08_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_124705 | 0 | 232 | 699 | 27780 | 9.68 | 0 | | | | | | | | | GO:0005737 | cytoplasm | | | GO:0016579 | protein deubiquitination | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0827300OROTU domain-containing protein, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0827300 OR OTU domain-containing protein, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0836000 | PY17X_0836000.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 828 | PY17X_0836000 | proteasome subunit beta type-6, putative | proteasome subunit beta type-6, putative | | | 8 | Py17X_08_v3:1,384,408..1,385,235(-) | Py17X_08_v3:1384408..1385235(-) | Py17X_08_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_101390 | 0 | 275 | 828 | 31709 | 7.74 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0005622 | intracellular | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0836000ORproteasome subunit beta type-6, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0836000 OR proteasome subunit beta type-6, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0836500 | PY17X_0836500.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1506 | PY17X_0836500 | M18 aspartyl aminopeptidase, putative | M18 aspartyl aminopeptidase, putative | | | 8 | Py17X_08_v3:1,399,531..1,401,036(-) | Py17X_08_v3:1399531..1401036(-) | Py17X_08_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_102047 | 0 | 501 | 1506 | 57480 | 6.56 | 0 | | | | | GO:0004177;GO:0008270 | aminopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | 3.4.11.21 (Aspartyl aminopeptidase) | 3.4.11.21 (Aspartyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0836500ORM18 aspartyl aminopeptidase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0836500 OR M18 aspartyl aminopeptidase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0837800 | PY17X_0837800.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1440 | PY17X_0837800 | mitochondrial-processing peptidase subunit beta, putative | mitochondrial-processing peptidase subunit beta, putative | | | 8 | Py17X_08_v3:1,439,109..1,440,548(-) | Py17X_08_v3:1439109..1440548(-) | Py17X_08_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_100777 | 0 | 479 | 1440 | 55004 | 6.63 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | GO:0006508 | proteolysis | GO:0017087 | mitochondrial processing peptidase complex | GO:0004222 | metalloendopeptidase activity | GO:0006627 | protein processing involved in protein targeting to mitochondrion | 3.4.24.64 (Mitochondrial processing peptidase) | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0837800ORmitochondrial-processing peptidase subunit beta, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0837800 OR mitochondrial-processing peptidase subunit beta, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0907400 | PY17X_0907400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1044 | PY17X_0907400 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | | | 9 | Py17X_09_v3:387,740..388,783(-) | Py17X_09_v3:387740..388783(-) | Py17X_09_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_101420 | 0 | 347 | 1044 | 40306 | 9.12 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0907400ORalpha/beta hydrolase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0907400 OR alpha/beta hydrolase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0908700 | PY17X_0908700.1 | 5 | 5 | 1 | | | reverse | protein coding | No | 933 | PY17X_0908700 | OTU domain-containing protein, putative | OTU domain-containing protein, putative | | | 9 | Py17X_09_v3:433,485..434,836(-) | Py17X_09_v3:433485..434836(-) | Py17X_09_v3 | Plasmodium yoelii yoelii 17X | 43 | OG6_102788 | 0 | 310 | 933 | 37100 | 7.11 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0908700OROTU domain-containing protein, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0908700 OR OTU domain-containing protein, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0913200 | PY17X_0913200.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 3678 | PY17X_0913200 | subtilisin-like protease 2, putative | subtilisin-like protease 2, putative | | | 9 | Py17X_09_v3:624,219..628,024(-) | Py17X_09_v3:624219..628024(-) | Py17X_09_v3 | Plasmodium yoelii yoelii 17X | 42 | OG6_100121 | 0 | 1225 | 3678 | 140861 | 8.54 | 1 | HMM: MLRTFYVLSLMLIEFILHKGQ, NN: MLRTFYVLSLMLIEFILHKGQYNK | NN Sum: 3, NN D: .53, HMM Prob: .08 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0020009;GO:0044310 | microneme;osmiophilic body | | | | | | 3.4.21.66 (Thermitase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0913200ORsubtilisin-like protease 2, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0913200 OR subtilisin-like protease 2, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0916500 | PY17X_0916500.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1674 | PY17X_0916500 | apical membrane antigen 1 | apical membrane antigen 1 | | | 9 | Py17X_09_v3:766,486..768,159(-) | Py17X_09_v3:766486..768159(-) | Py17X_09_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_130922 | 0 | 557 | 1674 | 63546 | 5.73 | 1 | NN: MKEIYYIFILCSIYLINLSYCS, HMM: MKEIYYIFILCSIYLINLSYCS | NN Sum: 3, NN D: .58, HMM Prob: .6 | GO:0016020 | membrane | | | GO:0009405 | pathogenesis | | | GO:0005515 | protein binding | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0916500ORapical membrane antigen 1ANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0916500 OR apical membrane antigen 1 AND Plasmodium yoelii yoelii 17X |
|
PY17X_0919400 | PY17X_0919400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1353 | PY17X_0919400 | 26S protease regulatory subunit 6A, putative | 26S protease regulatory subunit 6A, putative | | | 9 | Py17X_09_v3:867,280..868,632(-) | Py17X_09_v3:867280..868632(-) | Py17X_09_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_101915 | 0 | 450 | 1353 | 50784 | 4.74 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0008540 | proteasome regulatory particle, base subcomplex | | | GO:0070682;GO:0006511 | proteasome regulatory particle assembly;ubiquitin-dependent protein catabolic process | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0919400OR26S protease regulatory subunit 6A, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0919400 OR 26S protease regulatory subunit 6A, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0921600 | PY17X_0921600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1401 | PY17X_0921600 | GPI-anchor transamidase, putative | GPI-anchor transamidase, putative | | | 9 | Py17X_09_v3:928,070..929,470(-) | Py17X_09_v3:928070..929470(-) | Py17X_09_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_101767 | 0 | 466 | 1401 | 56048 | 9.21 | 2 | NN: MEIRIGIVIYLLVAIKCAIGS, HMM: MEIRIGIVIYLLVAIKCAIGS | NN Sum: 4, NN D: .76, HMM Prob: .85 | | | GO:0008233 | peptidase activity | GO:0006508 | proteolysis | | | GO:0003923 | GPI-anchor transamidase activity | GO:0016255 | attachment of GPI anchor to protein | | 3.-.-.- (Hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0921600ORGPI-anchor transamidase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0921600 OR GPI-anchor transamidase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0923800 | PY17X_0923800.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1743 | PY17X_0923800 | steryl ester hydrolase, putative | steryl ester hydrolase, putative | | | 9 | Py17X_09_v3:1,004,539..1,006,281(+) | Py17X_09_v3:1004539..1006281(+) | Py17X_09_v3 | Plasmodium yoelii yoelii 17X | 35 | OG6_100408 | 0 | 580 | 1743 | 67469 | 9.42 | 0 | | | | | | | GO:0006629 | lipid metabolic process | | | | | | | 3.1.1.13 (Sterol esterase) | 3.1.1.3 (Triacylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0923800ORsteryl ester hydrolase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0923800 OR steryl ester hydrolase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0928500 | PY17X_0928500.1 | 1 | 1 | 1 | | | forward | protein coding | No | 4902 | PY17X_0928500 | peptidase M16, putative | peptidase M16, putative | | | 9 | Py17X_09_v3:1,192,928..1,197,829(+) | Py17X_09_v3:1192928..1197829(+) | Py17X_09_v3 | Plasmodium yoelii yoelii 17X | 43 | OG6_108964 | 0 | 1633 | 4902 | 191944 | 7.92 | 0 | HMM: MYFNIFIFLIILVYENQSSCQ, NN: MYFNIFIFLIILVYENQSSCQ | NN Sum: 4, NN D: .67, HMM Prob: .79 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.55 (Pitrilysin) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0928500ORpeptidase M16, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0928500 OR peptidase M16, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0930500 | PY17X_0930500.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2949 | PY17X_0930500 | ATP-dependent zinc metalloprotease FTSH, putative | ATP-dependent zinc metalloprotease FTSH, putative | | | 9 | Py17X_09_v3:1,267,561..1,270,509(+) | Py17X_09_v3:1267561..1270509(+) | Py17X_09_v3 | Plasmodium yoelii yoelii 17X | 91 | OG6_100384 | 1 | 982 | 2949 | 111471 | 9.30 | 2 | | | GO:0016021;GO:0016020 | integral component of membrane;membrane | GO:0005524;GO:0004222;GO:0008270 | ATP binding;metalloendopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0930500ORATP-dependent zinc metalloprotease FTSH, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0930500 OR ATP-dependent zinc metalloprotease FTSH, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0931800 | PY17X_0931800.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3810 | PY17X_0931800 | insulinase, putative | insulinase, putative | | | 9 | Py17X_09_v3:1,307,543..1,311,352(-) | Py17X_09_v3:1307543..1311352(-) | Py17X_09_v3 | Plasmodium yoelii yoelii 17X | 46 | OG6_105738 | 1 | 1269 | 3810 | 146451 | 5.24 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0931800ORinsulinase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0931800 OR insulinase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0932900 | PY17X_0932900.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1260 | PY17X_0932900 | ubiquitin carboxyl-terminal hydrolase UCH54, putative | ubiquitin carboxyl-terminal hydrolase UCH54, putative | | | 9 | Py17X_09_v3:1,344,710..1,345,969(-) | Py17X_09_v3:1344710..1345969(-) | Py17X_09_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_102753 | 0 | 419 | 1260 | 49588 | 5.29 | 0 | | | GO:0005622 | intracellular | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0006511 | ubiquitin-dependent protein catabolic process | | | GO:0019784 | NEDD8-specific protease activity | GO:0000338;GO:0016579 | protein deneddylation;protein deubiquitination | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0932900ORubiquitin carboxyl-terminal hydrolase UCH54, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0932900 OR ubiquitin carboxyl-terminal hydrolase UCH54, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0933200 | PY17X_0933200.1 | 4 | 4 | 1 | | | forward | protein coding | No | 2730 | PY17X_0933200 | heat shock protein 101, putative | heat shock protein 101, putative | | | 9 | Py17X_09_v3:1,357,620..1,360,831(+) | Py17X_09_v3:1357620..1360831(+) | Py17X_09_v3 | Plasmodium yoelii yoelii 17X | 95 | OG6_100223 | 1 | 909 | 2730 | 103300 | 9.27 | 1 | NN: MVQNIVKNYLFVIVLLLSVLKVDITVFAS, HMM: MVQNIVKNYLFVIVLLLSVLKVDITVFAS | NN Sum: 3, NN D: .66, HMM Prob: .43 | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | GO:0097619;GO:0020026;GO:0020005 | PTEX complex;merozoite dense granule;symbiont-containing vacuole membrane | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0933200ORheat shock protein 101, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0933200 OR heat shock protein 101, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0933300 | PY17X_0933300.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2046 | PY17X_0933300 | dipeptidyl aminopeptidase 1, putative | dipeptidyl aminopeptidase 1, putative | | | 9 | Py17X_09_v3:1,363,625..1,365,670(+) | Py17X_09_v3:1363625..1365670(+) | Py17X_09_v3 | Plasmodium yoelii yoelii 17X | 90 | OG6_103622 | 1 | 681 | 2046 | 78202 | 6.33 | 1 | HMM: MKKISKFISLLLVSLHILYVSYVSAD, NN: MKKISKFISLLLVSLHILYVSYVSAD | NN Sum: 4, NN D: .89, HMM Prob: .99 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.14.1 (Dipeptidyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0933300ORdipeptidyl aminopeptidase 1, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0933300 OR dipeptidyl aminopeptidase 1, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0933800 | PY17X_0933800.1 | 7 | 7 | 1 | | | forward | protein coding | No | 681 | PY17X_0933800 | pyridoxine biosynthesis protein PDX2, putative | pyridoxine biosynthesis protein PDX2, putative | | | 9 | Py17X_09_v3:1,377,454..1,378,896(+) | Py17X_09_v3:1377454..1378896(+) | Py17X_09_v3 | Plasmodium yoelii yoelii 17X | 49 | OG6_103407 | 0 | 226 | 681 | 25523 | 7.12 | 0 | | | | | GO:0004359 | glutaminase activity | GO:0042823;GO:0042819 | pyridoxal phosphate biosynthetic process;vitamin B6 biosynthetic process | | | | | | | | 3.5.1.2 (Glutaminase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0933800ORpyridoxine biosynthesis protein PDX2, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0933800 OR pyridoxine biosynthesis protein PDX2, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0933900 | PY17X_0933900.1 | 1 | 1 | 1 | | | forward | protein coding | No | 4413 | PY17X_0933900 | serine esterase, putative | serine esterase, putative | | | 9 | Py17X_09_v3:1,380,563..1,384,975(+) | Py17X_09_v3:1380563..1384975(+) | Py17X_09_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_154686 | 0 | 1470 | 4413 | 174065 | 7.93 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0933900ORserine esterase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0933900 OR serine esterase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0934000 | PY17X_0934000.1 | 3 | 3 | 1 | | | forward | protein coding | No | 2727 | PY17X_0934000 | rhoptry neck protein 4 | rhoptry neck protein 4 | | | 9 | Py17X_09_v3:1,386,094..1,389,229(+) | Py17X_09_v3:1386094..1389229(+) | Py17X_09_v3 | Plasmodium yoelii yoelii 17X | 50 | OG6_118027 | 1 | 908 | 2727 | 102406 | 5.15 | 0 | HMM: MSGLRLFYACIFIVLSTFVHTA, NN: MSGLRLFYACIFIVLSTFVHTAKSF | NN Sum: 4, NN D: .86, HMM Prob: .97 | | | | | | | GO:0020008;GO:1990225 | rhoptry;rhoptry neck | GO:0005515 | protein binding | | | | 5.4.99.12 (tRNA pseudouridine(38-40) synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0934000ORrhoptry neck protein 4ANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0934000 OR rhoptry neck protein 4 AND Plasmodium yoelii yoelii 17X |
|
PY17X_0934400 | PY17X_0934400.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1419 | PY17X_0934400 | yoelipain-2 | yoelipain-2 | | | 9 | Py17X_09_v3:1,399,336..1,400,754(+) | Py17X_09_v3:1399336..1400754(+) | Py17X_09_v3 | Plasmodium yoelii yoelii 17X | 159 | OG6_100116 | 1 | 472 | 1419 | 55026 | 6.83 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0934400ORyoelipain-2ANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0934400 OR yoelipain-2 AND Plasmodium yoelii yoelii 17X |
|
PY17X_0935500 | PY17X_0935500.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 837 | PY17X_0935500 | rhomboid protease ROM1, putative | rhomboid protease ROM1, putative | | | 9 | Py17X_09_v3:1,438,603..1,439,897(-) | Py17X_09_v3:1438603..1439897(-) | Py17X_09_v3 | Plasmodium yoelii yoelii 17X | 93 | OG6_100562 | 1 | 278 | 837 | 31140 | 9.23 | 6 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | GO:0009986;GO:0020009 | cell surface;microneme | | | | | | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0935500ORrhomboid protease ROM1, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0935500 OR rhomboid protease ROM1, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0937700 | PY17X_0937700.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 705 | PY17X_0937700 | Josephin domain-containing protein, putative | Josephin domain-containing protein, putative | | | 9 | Py17X_09_v3:1,520,252..1,521,578(-) | Py17X_09_v3:1520252..1521578(-) | Py17X_09_v3 | Plasmodium yoelii yoelii 17X | 43 | OG6_104335 | 0 | 234 | 705 | 28160 | 9.11 | 0 | | | | | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0937700ORJosephin domain-containing protein, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0937700 OR Josephin domain-containing protein, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_0946700 | PY17X_0946700.1 | 1 | 1 | 1 | | | reverse | protein coding | Yes | 1080 | PY17X_0946700 | lysophospholipase, putative, pseudogene | lysophospholipase, putative, pseudogene | | | 9 | Py17X_09_v3:1,828,584..1,829,663(-) | Py17X_09_v3:1828584..1829663(-) | Py17X_09_v3 | Plasmodium yoelii yoelii 17X | 0 | N/A (orthology not determined because poor protein quality) | 0 | 359 | 1080 | 40984 | 4.96 | 0 | | | | | | | | | | | | | | | | 2.7.11.1 (Non-specific serine/threonine protein kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0946700ORlysophospholipase, putative, pseudogeneANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0946700 OR lysophospholipase, putative, pseudogene AND Plasmodium yoelii yoelii 17X |
|
PY17X_0947400 | PY17X_0947400.1 | 5 | 5 | 1 | | | reverse | protein coding | No | 690 | PY17X_0947400 | fam-a protein | fam-a protein | | | 9 | Py17X_09_v3:1,853,060..1,854,213(-) | Py17X_09_v3:1853060..1854213(-) | Py17X_09_v3 | Plasmodium yoelii yoelii 17X | 450 | OG6_100231 | 11 | 229 | 690 | 26359 | 4.61 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_0947400ORfam-a proteinANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_0947400 OR fam-a protein AND Plasmodium yoelii yoelii 17X |
|
PY17X_1001000 | PY17X_1001000.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1296 | PY17X_1001000 | lysophospholipase, putative | lysophospholipase, putative | | | 10 | Py17X_10_v3:141,659..142,954(+) | Py17X_10_v3:141659..142954(+) | Py17X_10_v3 | Plasmodium yoelii yoelii 17X | 450 | OG6_100231 | 11 | 431 | 1296 | 49887 | 5.82 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1001000ORlysophospholipase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1001000 OR lysophospholipase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1001400 | PY17X_1001400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2310 | PY17X_1001400 | lysophospholipase, putative | lysophospholipase, putative | | | 10 | Py17X_10_v3:155,924..158,233(-) | Py17X_10_v3:155924..158233(-) | Py17X_10_v3 | Plasmodium yoelii yoelii 17X | 450 | OG6_100231 | 11 | 769 | 2310 | 91210 | 3.89 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1001400ORlysophospholipase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1001400 OR lysophospholipase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1002500 | PY17X_1002500.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1161 | PY17X_1002500 | ubiquitin specific protease, putative | ubiquitin specific protease, putative | | | 10 | Py17X_10_v3:195,462..196,622(+) | Py17X_10_v3:195462..196622(+) | Py17X_10_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_208753 | 0 | 386 | 1161 | 45982 | 7.61 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1002500ORubiquitin specific protease, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1002500 OR ubiquitin specific protease, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1002900 | PY17X_1002900.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2145 | PY17X_1002900 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | | | 10 | Py17X_10_v3:214,956..217,100(-) | Py17X_10_v3:214956..217100(-) | Py17X_10_v3 | Plasmodium yoelii yoelii 17X | 135 | OG6_100915 | 2 | 714 | 2145 | 81039 | 9.66 | 0 | | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1002900ORalpha/beta hydrolase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1002900 OR alpha/beta hydrolase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1003800 | PY17X_1003800.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 2472 | PY17X_1003800 | dipeptidyl aminopeptidase 3, putative | dipeptidyl aminopeptidase 3, putative | | | 10 | Py17X_10_v3:267,169..269,837(-) | Py17X_10_v3:267169..269837(-) | Py17X_10_v3 | Plasmodium yoelii yoelii 17X | 5 | OG6_148524 | 0 | 823 | 2472 | 96757 | 8.28 | 0 | NN: MILIPLFFYIFLNYIKCD, HMM: MILIPLFFYIFLNYIKCD | NN Sum: 4, NN D: .67, HMM Prob: .38 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0045177;GO:0044164 | apical part of cell;host cell cytosol | GO:0004177 | aminopeptidase activity | | | 3.4.14.4 (Dipeptidyl-peptidase III) | 3.4.14.1 (Dipeptidyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1003800ORdipeptidyl aminopeptidase 3, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1003800 OR dipeptidyl aminopeptidase 3, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1007900 | PY17X_1007900.1 | 5 | 5 | 1 | | | forward | protein coding | No | 2055 | PY17X_1007900 | tRNA N6-adenosine threonylcarbamoyltransferase, putative | tRNA N6-adenosine threonylcarbamoyltransferase, putative | | | 10 | Py17X_10_v3:431,721..434,250(+) | Py17X_10_v3:431721..434250(+) | Py17X_10_v3 | Plasmodium yoelii yoelii 17X | 88 | OG6_100288 | 1 | 684 | 2055 | 79675 | 9.80 | 1 | HMM: MKLRASTCIVFFLLFFIPCLFNSY, NN: MKLRASTCIVFFLLFFIPCLFNSY | NN Sum: 4, NN D: .75, HMM Prob: .41 | | | | | | | | | | | | | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1007900ORtRNA N6-adenosine threonylcarbamoyltransferase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1007900 OR tRNA N6-adenosine threonylcarbamoyltransferase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1011800 | PY17X_1011800.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1716 | PY17X_1011800 | methionine aminopeptidase 2, putative | methionine aminopeptidase 2, putative | | | 10 | Py17X_10_v3:570,904..572,619(-) | Py17X_10_v3:570904..572619(-) | Py17X_10_v3 | Plasmodium yoelii yoelii 17X | 45 | OG6_100815 | 0 | 571 | 1716 | 65288 | 8.44 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1011800ORmethionine aminopeptidase 2, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1011800 OR methionine aminopeptidase 2, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1012800 | PY17X_1012800.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 300 | PY17X_1012800 | signal peptidase complex subunit SPC1, putative | signal peptidase complex subunit SPC1, putative | | | 10 | Py17X_10_v3:631,930..632,550(-) | Py17X_10_v3:631930..632550(-) | Py17X_10_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_103297 | 0 | 99 | 300 | 11329 | 9.96 | 2 | HMM: MGFFSCIINMIINTCVCLAR, NN: MGFFSCIINMIINTCVCLAR | NN Sum: 4, NN D: .57, HMM Prob: .23 | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1012800ORsignal peptidase complex subunit SPC1, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1012800 OR signal peptidase complex subunit SPC1, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1013800 | PY17X_1013800.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3492 | PY17X_1013800 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | | | 10 | Py17X_10_v3:679,962..683,453(+) | Py17X_10_v3:679962..683453(+) | Py17X_10_v3 | Plasmodium yoelii yoelii 17X | 42 | OG6_532401 | 0 | 1163 | 3492 | 137403 | 9.31 | 0 | | | | | GO:0003677 | DNA binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1013800ORconserved Plasmodium protein, unknown functionANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1013800 OR conserved Plasmodium protein, unknown function AND Plasmodium yoelii yoelii 17X |
|
PY17X_1016000 | PY17X_1016000.1 | 8 | 8 | 1 | | | reverse | protein coding | No | 1839 | PY17X_1016000 | plasmepsin IX, putative | plasmepsin IX, putative | | | 10 | Py17X_10_v3:757,268..760,049(-) | Py17X_10_v3:757268..760049(-) | Py17X_10_v3 | Plasmodium yoelii yoelii 17X | 91 | OG6_119797 | 1 | 612 | 1839 | 71875 | 9.59 | 1 | NN: MFFLTLKKLRKKYFLLFLTHPTITTLFFIYIFNLVKSD, HMM: MFFLTLKKLRKKYFLLFLTHPTITTLFFIYIFNLVKSD | NN Sum: 4, NN D: .59, HMM Prob: .06 | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | GO:0020008 | rhoptry | | | | | | 3.4.23.1 (Pepsin A) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1016000ORplasmepsin IX, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1016000 OR plasmepsin IX, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1017800 | PY17X_1017800.1 | 2 | 2 | 1 | | | forward | protein coding | No | 1134 | PY17X_1017800 | proliferation-associated protein 2g4, putative | proliferation-associated protein 2g4, putative | | | 10 | Py17X_10_v3:824,125..825,520(+) | Py17X_10_v3:824125..825520(+) | Py17X_10_v3 | Plasmodium yoelii yoelii 17X | 42 | OG6_101895 | 0 | 377 | 1134 | 42781 | 8.22 | 0 | | | | | | | | | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1017800ORproliferation-associated protein 2g4, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1017800 OR proliferation-associated protein 2g4, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1019000 | PY17X_1019000.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3183 | PY17X_1019000 | lipase, putative | lipase, putative | | | 10 | Py17X_10_v3:866,404..869,586(-) | Py17X_10_v3:866404..869586(-) | Py17X_10_v3 | Plasmodium yoelii yoelii 17X | 43 | OG6_145929 | 0 | 1060 | 3183 | 126622 | 5.69 | 1 | NN: MRLSLNLYYFALMHVFTNSF, HMM: MRLSLNLYYFALMHVFTNSF | NN Sum: 2, NN D: .55, HMM Prob: .25 | | | | | GO:0006629 | lipid metabolic process | | | | | | | | 3.1.1.3 (Triacylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1019000ORlipase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1019000 OR lipase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1020800 | PY17X_1020800.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1245 | PY17X_1020800 | enoyl-CoA hydratase, putative | enoyl-CoA hydratase, putative | | | 10 | Py17X_10_v3:924,871..926,115(+) | Py17X_10_v3:924871..926115(+) | Py17X_10_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_102410 | 0 | 414 | 1245 | 49004 | 8.74 | 0 | | | | | GO:0003824 | catalytic activity | GO:0008152 | metabolic process | | | | | | | 4.2.1.17 (Enoyl-CoA hydratase) | 4.2.1.17 (Enoyl-CoA hydratase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1020800ORenoyl-CoA hydratase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1020800 OR enoyl-CoA hydratase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1027800 | PY17X_1027800.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 3009 | PY17X_1027800 | cysteine protease ATG4, putative | cysteine protease ATG4, putative | | | 10 | Py17X_10_v3:1,164,089..1,167,364(-) | Py17X_10_v3:1164089..1167364(-) | Py17X_10_v3 | Plasmodium yoelii yoelii 17X | 41 | OG6_100501 | 0 | 1002 | 3009 | 118037 | 9.86 | 0 | | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1027800ORcysteine protease ATG4, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1027800 OR cysteine protease ATG4, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1028900 | PY17X_1028900.1 | 1 | 1 | 1 | | | forward | protein coding | No | 5646 | PY17X_1028900 | metacaspase-3, putative | metacaspase-3, putative | | | 10 | Py17X_10_v3:1,217,204..1,222,849(+) | Py17X_10_v3:1217204..1222849(+) | Py17X_10_v3 | Plasmodium yoelii yoelii 17X | 46 | OG6_119794 | 0 | 1881 | 5646 | 220095 | 9.41 | 0 | | | | | | | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1028900ORmetacaspase-3, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1028900 OR metacaspase-3, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1030200 | PY17X_1030200.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3162 | PY17X_1030200 | ATP-dependent protease, putative | ATP-dependent protease, putative | | | 10 | Py17X_10_v3:1,262,971..1,266,132(+) | Py17X_10_v3:1262971..1266132(+) | Py17X_10_v3 | Plasmodium yoelii yoelii 17X | 47 | OG6_100411 | 0 | 1053 | 3162 | 123034 | 8.64 | 0 | | | | | GO:0005524;GO:0004176;GO:0004252 | ATP binding;ATP-dependent peptidase activity;serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1030200ORATP-dependent protease, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1030200 OR ATP-dependent protease, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1030400 | PY17X_1030400.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3774 | PY17X_1030400 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | | 10 | Py17X_10_v3:1,270,191..1,273,964(+) | Py17X_10_v3:1270191..1273964(+) | Py17X_10_v3 | Plasmodium yoelii yoelii 17X | 48 | OG6_101457 | 0 | 1257 | 3774 | 150444 | 9.77 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1030400ORubiquitin carboxyl-terminal hydrolase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1030400 OR ubiquitin carboxyl-terminal hydrolase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1030600 | PY17X_1030600.1 | 5 | 5 | 1 | | | forward | protein coding | No | 6249 | PY17X_1030600 | atypical protein kinase, ABC-1 family, putative | atypical protein kinase, ABC-1 family, putative | | | 10 | Py17X_10_v3:1,278,645..1,285,447(+) | Py17X_10_v3:1278645..1285447(+) | Py17X_10_v3 | Plasmodium yoelii yoelii 17X | 48 | OG6_112296 | 0 | 2082 | 6249 | 245245 | 9.79 | 0 | | | | | | | | | | | | | | | | 1.14.13.- (With NADH or NADPH as one donor, and incorporation of one atom of oxygen.) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1030600ORatypical protein kinase, ABC-1 family, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1030600 OR atypical protein kinase, ABC-1 family, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1033700 | PY17X_1033700.1 | 4 | 4 | 1 | | | forward | protein coding | No | 1914 | PY17X_1033700 | rhomboid protease ROM8, putative | rhomboid protease ROM8, putative | | | 10 | Py17X_10_v3:1,394,966..1,397,460(+) | Py17X_10_v3:1394966..1397460(+) | Py17X_10_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_533440 | 0 | 637 | 1914 | 74109 | 9.92 | 5 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1033700ORrhomboid protease ROM8, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1033700 OR rhomboid protease ROM8, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1034800 | PY17X_1034800.1 | 7 | 7 | 1 | | | reverse | protein coding | No | 936 | PY17X_1034800 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | | | 10 | Py17X_10_v3:1,447,730..1,449,476(-) | Py17X_10_v3:1447730..1449476(-) | Py17X_10_v3 | Plasmodium yoelii yoelii 17X | 43 | OG6_112275 | 0 | 311 | 936 | 36413 | 9.55 | 0 | | | | | | | | | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1034800ORalpha/beta hydrolase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1034800 OR alpha/beta hydrolase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1035600 | PY17X_1035600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1158 | PY17X_1035600 | DNA damage-inducible protein 1, putative | DNA damage-inducible protein 1, putative | | | 10 | Py17X_10_v3:1,478,540..1,479,697(-) | Py17X_10_v3:1478540..1479697(-) | Py17X_10_v3 | Plasmodium yoelii yoelii 17X | 45 | OG6_101685 | 0 | 385 | 1158 | 44262 | 4.89 | 0 | | | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1035600ORDNA damage-inducible protein 1, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1035600 OR DNA damage-inducible protein 1, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1036800 | PY17X_1036800.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1353 | PY17X_1036800 | plasmepsin IV | plasmepsin IV | | | 10 | Py17X_10_v3:1,538,166..1,539,518(-) | Py17X_10_v3:1538166..1539518(-) | Py17X_10_v3 | Plasmodium yoelii yoelii 17X | 158 | OG6_100536 | 1 | 450 | 1353 | 50738 | 5.34 | 1 | | | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1036800ORplasmepsin IVANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1036800 OR plasmepsin IV AND Plasmodium yoelii yoelii 17X |
|
PY17X_1038000 | PY17X_1038000.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3402 | PY17X_1038000 | ATP-dependent Clp protease regulatory subunit ClpC, putative | ATP-dependent Clp protease regulatory subunit ClpC, putative | | | 10 | Py17X_10_v3:1,578,841..1,582,242(-) | Py17X_10_v3:1578841..1582242(-) | Py17X_10_v3 | Plasmodium yoelii yoelii 17X | 42 | OG6_532618 | 0 | 1133 | 3402 | 131554 | 8.57 | 0 | NN: MKDYHILIVIFMILRFVLNI, HMM: MKDYHILIVIFMILRFVLNIKISK | NN Sum: 4, NN D: .77, HMM Prob: .03 | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | GO:0020011 | apicoplast | | | | | | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1038000ORATP-dependent Clp protease regulatory subunit ClpC, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1038000 OR ATP-dependent Clp protease regulatory subunit ClpC, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1038100 | PY17X_1038100.1 | 2 | 2 | 1 | | | forward | protein coding | No | 4323 | PY17X_1038100 | WD repeat-containing protein 65, putative | WD repeat-containing protein 65, putative | | | 10 | Py17X_10_v3:1,583,982..1,588,519(+) | Py17X_10_v3:1583982..1588519(+) | Py17X_10_v3 | Plasmodium yoelii yoelii 17X | 49 | OG6_102663 | 1 | 1440 | 4323 | 170304 | 7.04 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1038100ORWD repeat-containing protein 65, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1038100 OR WD repeat-containing protein 65, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1107600 | PY17X_1107600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1980 | PY17X_1107600 | rhomboid protease ROM4, putative | rhomboid protease ROM4, putative | | | 11 | Py17X_11_v3:413,987..415,966(-) | Py17X_11_v3:413987..415966(-) | Py17X_11_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_126349 | 0 | 659 | 1980 | 74352 | 9.54 | 7 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1107600ORrhomboid protease ROM4, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1107600 OR rhomboid protease ROM4, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1107900 | PY17X_1107900.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1797 | PY17X_1107900 | subtilisin-like protease 3, putative | subtilisin-like protease 3, putative | | | 11 | Py17X_11_v3:422,817..424,613(-) | Py17X_11_v3:422817..424613(-) | Py17X_11_v3 | Plasmodium yoelii yoelii 17X | 42 | OG6_532299 | 0 | 598 | 1797 | 68597 | 9.74 | 0 | | | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | | | | 3.4.21.62 (Subtilisin) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1107900ORsubtilisin-like protease 3, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1107900 OR subtilisin-like protease 3, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1108000 | PY17X_1108000.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2595 | PY17X_1108000 | PIMMS2 protein, putative | PIMMS2 protein, putative | | | 11 | Py17X_11_v3:426,207..428,801(-) | Py17X_11_v3:426207..428801(-) | Py17X_11_v3 | Plasmodium yoelii yoelii 17X | 2 | OG6_491283 | 0 | 864 | 2595 | 100909 | 4.91 | 0 | | | | | | | | | GO:0071944;GO:0009986 | cell periphery;cell surface | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1108000ORPIMMS2 protein, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1108000 OR PIMMS2 protein, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1108200 | PY17X_1108200.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1785 | PY17X_1108200 | subtilisin-like protease 1, putative | subtilisin-like protease 1, putative | | | 11 | Py17X_11_v3:431,533..433,317(-) | Py17X_11_v3:431533..433317(-) | Py17X_11_v3 | Plasmodium yoelii yoelii 17X | 49 | OG6_121085 | 0 | 594 | 1785 | 66464 | 5.72 | 0 | NN: MRRFFIYGCVVSLALCTISAH, HMM: MRRFFIYGCVVSLALCTISAH | NN Sum: 4, NN D: .7, HMM Prob: .98 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0044311;GO:0020003 | exoneme;symbiont-containing vacuole | | | | | | 3.4.21.62 (Subtilisin) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1108200ORsubtilisin-like protease 1, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1108200 OR subtilisin-like protease 1, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1115900 | PY17X_1115900.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 1422 | PY17X_1115900 | rhomboid protease ROM9, putative | rhomboid protease ROM9, putative | | | 11 | Py17X_11_v3:726,359..728,169(-) | Py17X_11_v3:726359..728169(-) | Py17X_11_v3 | Plasmodium yoelii yoelii 17X | 6 | OG6_101864 | 0 | 473 | 1422 | 55719 | 10.30 | 6 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1115900ORrhomboid protease ROM9, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1115900 OR rhomboid protease ROM9, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1118900 | PY17X_1118900.1 | 8 | 8 | 1 | | | reverse | protein coding | No | 828 | PY17X_1118900 | rhomboid protease ROM10, putative | rhomboid protease ROM10, putative | | | 11 | Py17X_11_v3:835,171..836,890(-) | Py17X_11_v3:835171..836890(-) | Py17X_11_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_103838 | 0 | 275 | 828 | 31607 | 9.65 | 6 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1118900ORrhomboid protease ROM10, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1118900 OR rhomboid protease ROM10, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1127500 | PY17X_1127500.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1404 | PY17X_1127500 | E3 ubiquitin-protein ligase RNF5, putative | E3 ubiquitin-protein ligase RNF5, putative | | | 11 | Py17X_11_v3:1,131,714..1,133,117(-) | Py17X_11_v3:1131714..1133117(-) | Py17X_11_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_102074 | 0 | 467 | 1404 | 53680 | 4.53 | 1 | | | | | | | | | | | | | | | 6.3.2.19 (Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45) | 6.3.2.19 (Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1127500ORE3 ubiquitin-protein ligase RNF5, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1127500 OR E3 ubiquitin-protein ligase RNF5, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1127700 | PY17X_1127700.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 570 | PY17X_1127700 | protein DJ-1, putative | protein DJ-1, putative | | | 11 | Py17X_11_v3:1,136,206..1,137,272(-) | Py17X_11_v3:1136206..1137272(-) | Py17X_11_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_101257 | 0 | 189 | 570 | 20643 | 7.03 | 0 | | | | | | | | | GO:0005829 | cytosol | GO:0008233;GO:0036524 | peptidase activity;protein deglycase activity | GO:0036525;GO:0006457 | protein deglycation;protein folding | | 2.7.1.50 (Hydroxyethylthiazole kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1127700ORprotein DJ-1, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1127700 OR protein DJ-1, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1128600 | PY17X_1128600.1 | 8 | 8 | 1 | | | forward | protein coding | No | 1008 | PY17X_1128600 | protease, putative | protease, putative | | | 11 | Py17X_11_v3:1,200,419..1,202,573(+) | Py17X_11_v3:1200419..1202573(+) | Py17X_11_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_168022 | 0 | 335 | 1008 | 39549 | 7.80 | 8 | | | | | GO:0008233 | peptidase activity | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1128600ORprotease, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1128600 OR protease, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1129600 | PY17X_1129600.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2304 | PY17X_1129600 | phospholipase, putative | phospholipase, putative | | | 11 | Py17X_11_v3:1,227,885..1,230,188(+) | Py17X_11_v3:1227885..1230188(+) | Py17X_11_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_101376 | 0 | 767 | 2304 | 89060 | 4.55 | 1 | NN: MQVFLFIIILYNCICLTLIYSF, HMM: MQVFLFIIILYNCICLTLIYSF | NN Sum: 4, NN D: .77, HMM Prob: .92 | | | GO:0008374 | O-acyltransferase activity | GO:0006629 | lipid metabolic process | | | | | | | 2.3.1.43 (Phosphatidylcholine--sterol O-acyltransferase) | 2.3.1.43 (Phosphatidylcholine--sterol O-acyltransferase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1129600ORphospholipase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1129600 OR phospholipase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1131800 | PY17X_1131800.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 741 | PY17X_1131800 | proteasome subunit alpha type-4, putative | proteasome subunit alpha type-4, putative | | | 11 | Py17X_11_v3:1,329,576..1,330,436(-) | Py17X_11_v3:1329576..1330436(-) | Py17X_11_v3 | Plasmodium yoelii yoelii 17X | 45 | OG6_101968 | 0 | 246 | 741 | 27744 | 7.99 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1131800ORproteasome subunit alpha type-4, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1131800 OR proteasome subunit alpha type-4, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1131900 | PY17X_1131900.1 | 4 | 4 | 1 | | | forward | protein coding | No | 726 | PY17X_1131900 | proteasome subunit alpha type-7, putative | proteasome subunit alpha type-7, putative | | | 11 | Py17X_11_v3:1,331,977..1,333,111(+) | Py17X_11_v3:1331977..1333111(+) | Py17X_11_v3 | Plasmodium yoelii yoelii 17X | 45 | OG6_101207 | 0 | 241 | 726 | 27266 | 7.40 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1131900ORproteasome subunit alpha type-7, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1131900 OR proteasome subunit alpha type-7, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1132800 | PY17X_1132800.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1803 | PY17X_1132800 | metacaspase-1, putative | metacaspase-1, putative | | | 11 | Py17X_11_v3:1,356,850..1,358,652(-) | Py17X_11_v3:1356850..1358652(-) | Py17X_11_v3 | Plasmodium yoelii yoelii 17X | 83 | OG6_101407 | 1 | 600 | 1803 | 70769 | 8.73 | 0 | | | | | | | | | | | GO:0008233 | peptidase activity | GO:0006915;GO:0006508 | apoptotic process;proteolysis | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1132800ORmetacaspase-1, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1132800 OR metacaspase-1, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1134100 | PY17X_1134100.1 | 7 | 7 | 1 | | | forward | protein coding | No | 609 | PY17X_1134100 | ubiquitin-conjugating enzyme E2, putative | ubiquitin-conjugating enzyme E2, putative | | | 11 | Py17X_11_v3:1,404,318..1,405,807(+) | Py17X_11_v3:1404318..1405807(+) | Py17X_11_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_103192 | 0 | 202 | 609 | 22774 | 5.12 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 6.3.2.19 (Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1134100ORubiquitin-conjugating enzyme E2, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1134100 OR ubiquitin-conjugating enzyme E2, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1136100 | PY17X_1136100.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1002 | PY17X_1136100 | rhomboid protease ROM7, putative | rhomboid protease ROM7, putative | | | 11 | Py17X_11_v3:1,481,571..1,482,572(-) | Py17X_11_v3:1481571..1482572(-) | Py17X_11_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_533468 | 0 | 333 | 1002 | 39794 | 10.01 | 4 | HMM: MNLLILFIFIIYIARGN, NN: MNLLILFIFIIYIARGNSL | NN Sum: 4, NN D: .85, HMM Prob: .99 | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | GO:0020011 | apicoplast | | | | | 3.4.21.105 (Rhomboid protease) | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1136100ORrhomboid protease ROM7, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1136100 OR rhomboid protease ROM7, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1137600 | PY17X_1137600.1 | 1 | 1 | 1 | | | forward | protein coding | No | 5313 | PY17X_1137600 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | | | 11 | Py17X_11_v3:1,542,957..1,548,269(+) | Py17X_11_v3:1542957..1548269(+) | Py17X_11_v3 | Plasmodium yoelii yoelii 17X | 46 | OG6_156430 | 0 | 1770 | 5313 | 207116 | 9.55 | 4 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1137600ORconserved Plasmodium protein, unknown functionANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1137600 OR conserved Plasmodium protein, unknown function AND Plasmodium yoelii yoelii 17X |
|
PY17X_1138400 | PY17X_1138400.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3450 | PY17X_1138400 | falcilysin, putative | falcilysin, putative | | | 11 | Py17X_11_v3:1,579,319..1,582,768(+) | Py17X_11_v3:1579319..1582768(+) | Py17X_11_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_101809 | 0 | 1149 | 3450 | 133558 | 6.87 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1138400ORfalcilysin, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1138400 OR falcilysin, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1139800 | PY17X_1139800.1 | 1 | 1 | 1 | | | forward | protein coding | No | 5763 | PY17X_1139800 | calpain, putative | calpain, putative | | | 11 | Py17X_11_v3:1,632,538..1,638,300(+) | Py17X_11_v3:1632538..1638300(+) | Py17X_11_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_103851 | 0 | 1920 | 5763 | 225633 | 9.93 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1139800ORcalpain, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1139800 OR calpain, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1145300 | PY17X_1145300.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 936 | PY17X_1145300 | 26S proteasome regulatory subunit RPN11, putative | 26S proteasome regulatory subunit RPN11, putative | | | 11 | Py17X_11_v3:1,829,272..1,830,526(-) | Py17X_11_v3:1829272..1830526(-) | Py17X_11_v3 | Plasmodium yoelii yoelii 17X | 43 | OG6_101835 | 0 | 311 | 936 | 35168 | 6.63 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1145300OR26S proteasome regulatory subunit RPN11, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1145300 OR 26S proteasome regulatory subunit RPN11, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1207100 | PY17X_1207100.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 2097 | PY17X_1207100 | peptidase, putative | peptidase, putative | | | 12 | Py17X_12_v3:360,640..362,883(-) | Py17X_12_v3:360640..362883(-) | Py17X_12_v3 | Plasmodium yoelii yoelii 17X | 45 | OG6_100561 | 0 | 698 | 2097 | 83549 | 9.61 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.15 (Thimet oligopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1207100ORpeptidase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1207100 OR peptidase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1208300 | PY17X_1208300.1 | 9 | 9 | 1 | | | forward | protein coding | No | 657 | PY17X_1208300 | PPPDE peptidase, putative | PPPDE peptidase, putative | | | 12 | Py17X_12_v3:393,431..395,133(+) | Py17X_12_v3:393431..395133(+) | Py17X_12_v3 | Plasmodium yoelii yoelii 17X | 90 | OG6_101256 | 1 | 218 | 657 | 24503 | 9.15 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1208300ORPPPDE peptidase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1208300 OR PPPDE peptidase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1209800 | PY17X_1209800.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1344 | PY17X_1209800 | 26S protease regulatory subunit 4, putative | 26S protease regulatory subunit 4, putative | | | 12 | Py17X_12_v3:456,365..458,109(-) | Py17X_12_v3:456365..458109(-) | Py17X_12_v3 | Plasmodium yoelii yoelii 17X | 45 | OG6_101477 | 0 | 447 | 1344 | 49708 | 8.04 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0008540 | proteasome regulatory particle, base subcomplex | | | GO:0070682;GO:0006511 | proteasome regulatory particle assembly;ubiquitin-dependent protein catabolic process | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1209800OR26S protease regulatory subunit 4, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1209800 OR 26S protease regulatory subunit 4, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1211000 | PY17X_1211000.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 1056 | PY17X_1211000 | metalloprotease, putative | metalloprotease, putative | | | 12 | Py17X_12_v3:491,960..493,390(-) | Py17X_12_v3:491960..493390(-) | Py17X_12_v3 | Plasmodium yoelii yoelii 17X | 45 | OG6_108834 | 0 | 351 | 1056 | 40571 | 9.74 | 0 | | | | | | | | | | | GO:0008237 | metallopeptidase activity | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1211000ORmetalloprotease, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1211000 OR metalloprotease, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1213000 | PY17X_1213000.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 813 | PY17X_1213000 | proteasome subunit beta type-5, putative | proteasome subunit beta type-5, putative | | | 12 | Py17X_12_v3:555,804..556,616(-) | Py17X_12_v3:555804..556616(-) | Py17X_12_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_100897 | 0 | 270 | 813 | 30639 | 4.91 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1213000ORproteasome subunit beta type-5, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1213000 OR proteasome subunit beta type-5, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1216900 | PY17X_1216900.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1476 | PY17X_1216900 | methionine aminopeptidase 1b, putative | methionine aminopeptidase 1b, putative | | | 12 | Py17X_12_v3:718,483..719,958(+) | Py17X_12_v3:718483..719958(+) | Py17X_12_v3 | Plasmodium yoelii yoelii 17X | 43 | OG6_100342 | 0 | 491 | 1476 | 56395 | 7.29 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1216900ORmethionine aminopeptidase 1b, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1216900 OR methionine aminopeptidase 1b, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1220200 | PY17X_1220200.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2622 | PY17X_1220200 | peptidase, putative | peptidase, putative | | | 12 | Py17X_12_v3:844,256..846,877(+) | Py17X_12_v3:844256..846877(+) | Py17X_12_v3 | Plasmodium yoelii yoelii 17X | 45 | OG6_102438 | 0 | 873 | 2622 | 101963 | 6.80 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.19.1 (Acylaminoacyl-peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1220200ORpeptidase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1220200 OR peptidase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1221000 | PY17X_1221000.1 | 8 | 8 | 1 | | | reverse | protein coding | No | 552 | PY17X_1221000 | signal peptidase complex subunit 2, putative | signal peptidase complex subunit 2, putative | | | 12 | Py17X_12_v3:875,817..877,340(-) | Py17X_12_v3:875817..877340(-) | Py17X_12_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_137524 | 0 | 183 | 552 | 21928 | 8.91 | 2 | | | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | GO:0005783;GO:0005787 | endoplasmic reticulum;signal peptidase complex | | | GO:0045047;GO:0006465 | protein targeting to ER;signal peptide processing | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1221000ORsignal peptidase complex subunit 2, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1221000 OR signal peptidase complex subunit 2, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1223400 | PY17X_1223400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1782 | PY17X_1223400 | lysophospholipase, putative | lysophospholipase, putative | | | 12 | Py17X_12_v3:971,571..973,352(-) | Py17X_12_v3:971571..973352(-) | Py17X_12_v3 | Plasmodium yoelii yoelii 17X | 450 | OG6_100231 | 11 | 593 | 1782 | 68871 | 4.48 | 0 | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1223400ORlysophospholipase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1223400 OR lysophospholipase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1223500 | PY17X_1223500.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1131 | PY17X_1223500 | prodrug activation and resistance esterase, putative | prodrug activation and resistance esterase, putative | | | 12 | Py17X_12_v3:976,405..977,535(-) | Py17X_12_v3:976405..977535(-) | Py17X_12_v3 | Plasmodium yoelii yoelii 17X | 450 | OG6_100231 | 11 | 376 | 1131 | 43035 | 8.41 | 0 | | | | | | | | | GO:0005737 | cytoplasm | GO:0047372;GO:0016788 | acylglycerol lipase activity;hydrolase activity, acting on ester bonds | GO:0052651;GO:0042493 | monoacylglycerol catabolic process;response to drug | 3.1.1.23 (Acylglycerol lipase) | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1223500ORprodrug activation and resistance esterase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1223500 OR prodrug activation and resistance esterase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1223700 | PY17X_1223700.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 5664 | PY17X_1223700 | conserved protein, unknown function | conserved protein, unknown function | | | 12 | Py17X_12_v3:980,293..986,262(-) | Py17X_12_v3:980293..986262(-) | Py17X_12_v3 | Plasmodium yoelii yoelii 17X | 43 | OG6_113142 | 0 | 1887 | 5664 | 220479 | 9.96 | 4 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1223700ORconserved protein, unknown functionANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1223700 OR conserved protein, unknown function AND Plasmodium yoelii yoelii 17X |
|
PY17X_1225700 | PY17X_1225700.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1668 | PY17X_1225700 | plasmepsin X, putative | plasmepsin X, putative | | | 12 | Py17X_12_v3:1,052,297..1,053,964(+) | Py17X_12_v3:1052297..1053964(+) | Py17X_12_v3 | Plasmodium yoelii yoelii 17X | 91 | OG6_119797 | 1 | 555 | 1668 | 62867 | 5.51 | 0 | HMM: MKSIKILPVFYLVAFFLHNYNEITCN, NN: MKSIKILPVFYLVAFFLHNYNEITCN | NN Sum: 3, NN D: .52, HMM Prob: .32 | | | | | | | GO:0044311 | exoneme | GO:0004190 | aspartic-type endopeptidase activity | GO:0030260;GO:0035891;GO:0006508 | entry into host cell;exit from host cell;proteolysis | | 3.4.23.1 (Pepsin A) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1225700ORplasmepsin X, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1225700 OR plasmepsin X, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1225900 | PY17X_1225900.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3492 | PY17X_1225900 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | | | 12 | Py17X_12_v3:1,060,813..1,064,304(-) | Py17X_12_v3:1060813..1064304(-) | Py17X_12_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_128391 | 0 | 1163 | 3492 | 139368 | 9.81 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1225900ORconserved Plasmodium protein, unknown functionANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1225900 OR conserved Plasmodium protein, unknown function AND Plasmodium yoelii yoelii 17X |
|
PY17X_1226100 | PY17X_1226100.1 | 2 | 2 | 1 | | | forward | protein coding | No | 1263 | PY17X_1226100 | 26S proteasome regulatory subunit RPN10, putative | 26S proteasome regulatory subunit RPN10, putative | | | 12 | Py17X_12_v3:1,067,634..1,069,010(+) | Py17X_12_v3:1067634..1069010(+) | Py17X_12_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_102002 | 0 | 420 | 1263 | 47542 | 4.45 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1226100OR26S proteasome regulatory subunit RPN10, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1226100 OR 26S proteasome regulatory subunit RPN10, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1226300 | PY17X_1226300.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 783 | PY17X_1226300 | proteasome subunit alpha type-6, putative | proteasome subunit alpha type-6, putative | | | 12 | Py17X_12_v3:1,075,440..1,076,642(-) | Py17X_12_v3:1075440..1076642(-) | Py17X_12_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_102240 | 0 | 260 | 783 | 29618 | 5.04 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1226300ORproteasome subunit alpha type-6, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1226300 OR proteasome subunit alpha type-6, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1228800 | PY17X_1228800.1 | 7 | 7 | 1 | | | forward | protein coding | No | 732 | PY17X_1228800 | alpha/beta hydrolase, putative | alpha/beta hydrolase, putative | | | 12 | Py17X_12_v3:1,172,835..1,174,289(+) | Py17X_12_v3:1172835..1174289(+) | Py17X_12_v3 | Plasmodium yoelii yoelii 17X | 135 | OG6_100915 | 2 | 243 | 732 | 28215 | 5.61 | 0 | | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1228800ORalpha/beta hydrolase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1228800 OR alpha/beta hydrolase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1229400 | PY17X_1229400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2043 | PY17X_1229400 | methionine aminopeptidase 1c, putative | methionine aminopeptidase 1c, putative | | | 12 | Py17X_12_v3:1,206,805..1,208,847(-) | Py17X_12_v3:1206805..1208847(-) | Py17X_12_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_171502 | 0 | 680 | 2043 | 81478 | 9.18 | 0 | HMM: MNVHIFLLLLFCGTFLCK, NN: MNVHIFLLLLFCGTFLCKKNSN | NN Sum: 3, NN D: .58, HMM Prob: .96 | | | | | | | | | GO:0003729;GO:0070006;GO:0008235 | mRNA binding;metalloaminopeptidase activity;metalloexopeptidase activity | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1229400ORmethionine aminopeptidase 1c, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1229400 OR methionine aminopeptidase 1c, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1230000 | PY17X_1230000.1 | 2 | 2 | 1 | | | forward | protein coding | No | 771 | PY17X_1230000 | proteasome subunit beta type-4, putative | proteasome subunit beta type-4, putative | | | 12 | Py17X_12_v3:1,219,435..1,220,332(+) | Py17X_12_v3:1219435..1220332(+) | Py17X_12_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_101718 | 0 | 256 | 771 | 29750 | 6.67 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1230000ORproteasome subunit beta type-4, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1230000 OR proteasome subunit beta type-4, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1232000 | PY17X_1232000.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 4410 | PY17X_1232000 | sentrin-specific protease 2, putative | sentrin-specific protease 2, putative | | | 12 | Py17X_12_v3:1,314,617..1,319,399(-) | Py17X_12_v3:1314617..1319399(-) | Py17X_12_v3 | Plasmodium yoelii yoelii 17X | 6 | OG6_102905 | 0 | 1469 | 4410 | 175592 | 8.67 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1232000ORsentrin-specific protease 2, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1232000 OR sentrin-specific protease 2, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1234900 | PY17X_1234900.1 | 3 | 3 | 1 | | | forward | protein coding | No | 3660 | PY17X_1234900 | ubiquitin carboxyl-terminal hydrolase 2, putative | ubiquitin carboxyl-terminal hydrolase 2, putative | | | 12 | Py17X_12_v3:1,423,866..1,427,801(+) | Py17X_12_v3:1423866..1427801(+) | Py17X_12_v3 | Plasmodium yoelii yoelii 17X | 48 | OG6_101021 | 0 | 1219 | 3660 | 142434 | 7.11 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1234900ORubiquitin carboxyl-terminal hydrolase 2, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1234900 OR ubiquitin carboxyl-terminal hydrolase 2, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1235600 | PY17X_1235600.1 | 3 | 3 | 1 | | | forward | protein coding | No | 3300 | PY17X_1235600 | FACT complex subunit SPT16, putative | FACT complex subunit SPT16, putative | | | 12 | Py17X_12_v3:1,456,285..1,459,838(+) | Py17X_12_v3:1456285..1459838(+) | Py17X_12_v3 | Plasmodium yoelii yoelii 17X | 38 | OG6_102309 | 0 | 1099 | 3300 | 127734 | 4.74 | 0 | | | | | | | | | GO:0005634 | nucleus | | | | | | 1.1.1.27 (L-lactate dehydrogenase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1235600ORFACT complex subunit SPT16, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1235600 OR FACT complex subunit SPT16, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1235900 | PY17X_1235900.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2151 | PY17X_1235900 | eukaryotic translation initiation factor 3 subunit B, putative | eukaryotic translation initiation factor 3 subunit B, putative | | | 12 | Py17X_12_v3:1,467,773..1,469,923(+) | Py17X_12_v3:1467773..1469923(+) | Py17X_12_v3 | Plasmodium yoelii yoelii 17X | 45 | OG6_101924 | 0 | 716 | 2151 | 84166 | 8.84 | 0 | | | GO:0005852 | eukaryotic translation initiation factor 3 complex | GO:0003723;GO:0003676;GO:0003743;GO:0031369 | RNA binding;nucleic acid binding;translation initiation factor activity;translation initiation factor binding | GO:0006413 | translational initiation | | | | | | | | 3.6.3.14 (Transferred entry: 7.1.2.2) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1235900OReukaryotic translation initiation factor 3 subunit B, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1235900 OR eukaryotic translation initiation factor 3 subunit B, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1236500 | PY17X_1236500.1 | 4 | 4 | 1 | | | reverse | protein coding | No | 729 | PY17X_1236500 | proteasome subunit beta type-1, putative | proteasome subunit beta type-1, putative | | | 12 | Py17X_12_v3:1,484,006..1,485,341(-) | Py17X_12_v3:1484006..1485341(-) | Py17X_12_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_101631 | 0 | 242 | 729 | 27337 | 6.78 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1236500ORproteasome subunit beta type-1, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1236500 OR proteasome subunit beta type-1, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1241100 | PY17X_1241100.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1605 | PY17X_1241100 | mitochondrial-processing peptidase subunit alpha, putative | mitochondrial-processing peptidase subunit alpha, putative | | | 12 | Py17X_12_v3:1,672,932..1,674,731(-) | Py17X_12_v3:1672932..1674731(-) | Py17X_12_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_102381 | 0 | 534 | 1605 | 61250 | 9.07 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | GO:0017087;GO:0005739 | mitochondrial processing peptidase complex;mitochondrion | GO:0004222 | metalloendopeptidase activity | GO:0006627 | protein processing involved in protein targeting to mitochondrion | 3.4.24.64 (Mitochondrial processing peptidase) | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1241100ORmitochondrial-processing peptidase subunit alpha, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1241100 OR mitochondrial-processing peptidase subunit alpha, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1245200 | PY17X_1245200.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1596 | PY17X_1245200 | ubiquitin carboxyl-terminal hydrolase 14, putative | ubiquitin carboxyl-terminal hydrolase 14, putative | | | 12 | Py17X_12_v3:1,810,196..1,812,258(-) | Py17X_12_v3:1810196..1812258(-) | Py17X_12_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_101892 | 0 | 531 | 1596 | 61679 | 7.71 | 0 | | | | | GO:0005515;GO:0036459 | protein binding;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1245200ORubiquitin carboxyl-terminal hydrolase 14, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1245200 OR ubiquitin carboxyl-terminal hydrolase 14, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1245300 | PY17X_1245300.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 993 | PY17X_1245300 | methionine aminopeptidase 1a, putative | methionine aminopeptidase 1a, putative | | | 12 | Py17X_12_v3:1,813,558..1,815,507(-) | Py17X_12_v3:1813558..1815507(-) | Py17X_12_v3 | Plasmodium yoelii yoelii 17X | 43 | OG6_124490 | 0 | 330 | 993 | 37622 | 7.34 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | | | GO:0003729;GO:0070006 | mRNA binding;metalloaminopeptidase activity | | | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1245300ORmethionine aminopeptidase 1a, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1245300 OR methionine aminopeptidase 1a, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1305000 | PY17X_1305000.1 | 3 | 3 | 1 | | | reverse | protein coding | No | 762 | PY17X_1305000 | proteasome subunit alpha type-1, putative | proteasome subunit alpha type-1, putative | | | 13 | Py17X_13_v3:443,626..444,744(-) | Py17X_13_v3:443626..444744(-) | Py17X_13_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_102143 | 0 | 253 | 762 | 28877 | 6.78 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1305000ORproteasome subunit alpha type-1, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1305000 OR proteasome subunit alpha type-1, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1306100 | PY17X_1306100.1 | 7 | 7 | 1 | | | forward | protein coding | No | 5238 | PY17X_1306100 | metacaspase-2, putative | metacaspase-2, putative | | | 13 | Py17X_13_v3:497,017..503,608(+) | Py17X_13_v3:497017..503608(+) | Py17X_13_v3 | Plasmodium yoelii yoelii 17X | 83 | OG6_101407 | 1 | 1745 | 5238 | 202976 | 10.04 | 0 | | | | | | | | | GO:0005737 | cytoplasm | GO:0008234 | cysteine-type peptidase activity | GO:0006915 | apoptotic process | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1306100ORmetacaspase-2, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1306100 OR metacaspase-2, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1309400 | PY17X_1309400.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1356 | PY17X_1309400 | mitochondrial inner membrane protease ATP23, putative | mitochondrial inner membrane protease ATP23, putative | | | 13 | Py17X_13_v3:643,718..645,073(+) | Py17X_13_v3:643718..645073(+) | Py17X_13_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_102968 | 0 | 451 | 1356 | 53070 | 9.17 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | | | GO:0005758 | mitochondrial intermembrane space | | | GO:0034982;GO:0033615 | mitochondrial protein processing;mitochondrial proton-transporting ATP synthase complex assembly | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1309400ORmitochondrial inner membrane protease ATP23, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1309400 OR mitochondrial inner membrane protease ATP23, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1313800 | PY17X_1313800.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1926 | PY17X_1313800 | M17 leucyl aminopeptidase, putative | M17 leucyl aminopeptidase, putative | | | 13 | Py17X_13_v3:820,730..822,655(-) | Py17X_13_v3:820730..822655(-) | Py17X_13_v3 | Plasmodium yoelii yoelii 17X | 47 | OG6_100682 | 0 | 641 | 1926 | 72745 | 9.01 | 0 | | | GO:0005737;GO:0005622 | cytoplasm;intracellular | GO:0004177;GO:0030145;GO:0008235 | aminopeptidase activity;manganese ion binding;metalloexopeptidase activity | GO:0019538;GO:0006508 | protein metabolic process;proteolysis | | | | | | | 3.4.11.1 (Leucyl aminopeptidase) | 3.4.11.1 (Leucyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1313800ORM17 leucyl aminopeptidase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1313800 OR M17 leucyl aminopeptidase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1319800 | PY17X_1319800.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1062 | PY17X_1319800 | DER1-like protein, putative | DER1-like protein, putative | | | 13 | Py17X_13_v3:1,039,675..1,040,736(-) | Py17X_13_v3:1039675..1040736(-) | Py17X_13_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_160757 | 0 | 353 | 1062 | 41613 | 10.15 | 6 | HMM: MKMCIFFYVLLFFIYIIGI, NN: MKMCIFFYVLLFFIYIIGI | NN Sum: 4, NN D: .74, HMM Prob: .42 | | | | | | | GO:0020011 | apicoplast | | | GO:0030433 | ubiquitin-dependent ERAD pathway | | | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1319800ORDER1-like protein, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1319800 OR DER1-like protein, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1321900 | PY17X_1321900.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2334 | PY17X_1321900 | aminopeptidase P, putative | aminopeptidase P, putative | | | 13 | Py17X_13_v3:1,123,290..1,125,623(+) | Py17X_13_v3:1123290..1125623(+) | Py17X_13_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_100896 | 0 | 777 | 2334 | 90015 | 7.40 | 0 | HMM: MRINSLIYANLLFTAIHAN, NN: MRINSLIYANLLFTAIHAN | NN Sum: 3, NN D: .59, HMM Prob: .73 | | | GO:0016787 | hydrolase activity | | | GO:0005829;GO:0020020 | cytosol;food vacuole | GO:0070006;GO:0042803 | metalloaminopeptidase activity;protein homodimerization activity | | | | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1321900ORaminopeptidase P, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1321900 OR aminopeptidase P, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1324500 | PY17X_1324500.1 | 9 | 9 | 1 | | | reverse | protein coding | No | 1236 | PY17X_1324500 | signal peptide peptidase, putative | signal peptide peptidase, putative | | | 13 | Py17X_13_v3:1,218,967..1,221,649(-) | Py17X_13_v3:1218967..1221649(-) | Py17X_13_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_102328 | 0 | 411 | 1236 | 47378 | 9.44 | 8 | | | GO:0016021 | integral component of membrane | GO:0004190 | aspartic-type endopeptidase activity | | | | | | | | | 3.4.21.89 (Signal peptidase I) | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1324500ORsignal peptide peptidase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1324500 OR signal peptide peptidase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1325500 | PY17X_1325500.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1563 | PY17X_1325500 | yoelipain-1 | yoelipain-1 | | | 13 | Py17X_13_v3:1,267,803..1,269,365(+) | Py17X_13_v3:1267803..1269365(+) | Py17X_13_v3 | Plasmodium yoelii yoelii 17X | 159 | OG6_100116 | 1 | 520 | 1563 | 60333 | 6.70 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1325500ORyoelipain-1ANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1325500 OR yoelipain-1 AND Plasmodium yoelii yoelii 17X |
|
PY17X_1327900 | PY17X_1327900.1 | 9 | 9 | 1 | | | forward | protein coding | No | 687 | PY17X_1327900 | ubiquitin carboxyl-terminal hydrolase isozyme L3, putative | ubiquitin carboxyl-terminal hydrolase isozyme L3, putative | | | 13 | Py17X_13_v3:1,333,983..1,335,659(+) | Py17X_13_v3:1333983..1335659(+) | Py17X_13_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_101218 | 0 | 228 | 687 | 25848 | 4.91 | 0 | | | GO:0005622 | intracellular | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0006511 | ubiquitin-dependent protein catabolic process | | | GO:0019784 | NEDD8-specific protease activity | GO:0000338 | protein deneddylation | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1327900ORubiquitin carboxyl-terminal hydrolase isozyme L3, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1327900 OR ubiquitin carboxyl-terminal hydrolase isozyme L3, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1333000 | PY17X_1333000.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2112 | PY17X_1333000 | ATP-dependent zinc metalloprotease FTSH, putative | ATP-dependent zinc metalloprotease FTSH, putative | | | 13 | Py17X_13_v3:1,510,959..1,513,070(-) | Py17X_13_v3:1510959..1513070(-) | Py17X_13_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_101196 | 0 | 703 | 2112 | 79364 | 9.60 | 0 | | | GO:0016020 | membrane | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1333000ORATP-dependent zinc metalloprotease FTSH, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1333000 OR ATP-dependent zinc metalloprotease FTSH, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1333800 | PY17X_1333800.1 | 13 | 13 | 1 | | | reverse | protein coding | No | 1122 | PY17X_1333800 | plasmepsin VIII, putative | plasmepsin VIII, putative | | | 13 | Py17X_13_v3:1,538,051..1,540,591(-) | Py17X_13_v3:1538051..1540591(-) | Py17X_13_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_124673 | 0 | 373 | 1122 | 42202 | 9.38 | 0 | NN: MNKFFVFPLLLILNSIVLVKSLTE, HMM: MNKFFVFPLLLILNSIVLVKSL | NN Sum: 4, NN D: .72, HMM Prob: .98 | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.17.4 (Gly-Xaa carboxypeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1333800ORplasmepsin VIII, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1333800 OR plasmepsin VIII, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1336500 | PY17X_1336500.1 | 6 | 6 | 1 | | | reverse | protein coding | No | 657 | PY17X_1336500 | derlin-1, putative | derlin-1, putative | | | 13 | Py17X_13_v3:1,672,441..1,673,877(-) | Py17X_13_v3:1672441..1673877(-) | Py17X_13_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_101672 | 0 | 218 | 657 | 25643 | 7.33 | 5 | HMM: MVQLGELLSNIPLITRVYLILSSILMVLCSLD, NN: MVQLGELLSNIPLITRVYLILSSILMVLCS | NN Sum: 2, NN D: .54, HMM Prob: .1 | | | | | | | GO:0005783;GO:0005789 | endoplasmic reticulum;endoplasmic reticulum membrane | | | GO:0030970;GO:0030433 | retrograde protein transport, ER to cytosol;ubiquitin-dependent ERAD pathway | | | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1336500ORderlin-1, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1336500 OR derlin-1, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1337500 | PY17X_1337500.1 | 3 | 3 | 1 | | | forward | protein coding | No | 8985 | PY17X_1337500 | acetyl-CoA carboxylase, putative | acetyl-CoA carboxylase, putative | | | 13 | Py17X_13_v3:1,707,853..1,717,246(+) | Py17X_13_v3:1707853..1717246(+) | Py17X_13_v3 | Plasmodium yoelii yoelii 17X | 41 | OG6_101052 | 0 | 2994 | 8985 | 347004 | 7.95 | 0 | NN: MISIFLSILLFVLIFENPTKSI, HMM: MISIFLSILLFVLIFENPTKSI | NN Sum: 4, NN D: .84, HMM Prob: .97 | | | GO:0005524;GO:0016874;GO:0046872 | ATP binding;ligase activity;metal ion binding | | | GO:0020011 | apicoplast | | | | | 6.4.1.2 (Acetyl-CoA carboxylase) | 6.4.1.2 (Acetyl-CoA carboxylase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1337500ORacetyl-CoA carboxylase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1337500 OR acetyl-CoA carboxylase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1338800 | PY17X_1338800.1 | 2 | 2 | 1 | | | forward | protein coding | No | 588 | PY17X_1338800 | proteasome subunit beta type-2, putative | proteasome subunit beta type-2, putative | | | 13 | Py17X_13_v3:1,750,777..1,751,615(+) | Py17X_13_v3:1750777..1751615(+) | Py17X_13_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_102061 | 0 | 195 | 588 | 22864 | 8.25 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1338800ORproteasome subunit beta type-2, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1338800 OR proteasome subunit beta type-2, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1339800 | PY17X_1339800.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 5865 | PY17X_1339800 | conserved Plasmodium protein, unknown function | conserved Plasmodium protein, unknown function | | | 13 | Py17X_13_v3:1,782,399..1,788,625(-) | Py17X_13_v3:1782399..1788625(-) | Py17X_13_v3 | Plasmodium yoelii yoelii 17X | 5 | OG6r1_110052 | 0 | 1954 | 5865 | 234320 | 9.50 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1339800ORconserved Plasmodium protein, unknown functionANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1339800 OR conserved Plasmodium protein, unknown function AND Plasmodium yoelii yoelii 17X |
|
PY17X_1340300 | PY17X_1340300.1 | 3 | 3 | 1 | | | forward | protein coding | No | 3345 | PY17X_1340300 | M1-family alanyl aminopeptidase, putative | M1-family alanyl aminopeptidase, putative | | | 13 | Py17X_13_v3:1,802,620..1,806,307(+) | Py17X_13_v3:1802620..1806307(+) | Py17X_13_v3 | Plasmodium yoelii yoelii 17X | 37 | OG6_532703 | 0 | 1114 | 3345 | 135651 | 10.30 | 4 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | | 3.4.11.2 (Membrane alanyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1340300ORM1-family alanyl aminopeptidase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1340300 OR M1-family alanyl aminopeptidase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1343400 | PY17X_1343400.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1707 | PY17X_1343400 | plasmepsin V, putative | plasmepsin V, putative | | | 13 | Py17X_13_v3:1,904,063..1,905,769(+) | Py17X_13_v3:1904063..1905769(+) | Py17X_13_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_107443 | 0 | 568 | 1707 | 65807 | 7.40 | 1 | HMM: MGFSKLYNFIIYFIIINILVQANSE, NN: MGFSKLYNFIIYFIIINILVQANSE | NN Sum: 4, NN D: .72, HMM Prob: .36 | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005783 | endoplasmic reticulum | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1343400ORplasmepsin V, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1343400 OR plasmepsin V, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1348000 | PY17X_1348000.1 | 1 | 1 | 1 | | | forward | protein coding | No | 813 | PY17X_1348000 | proteasome subunit beta type-7, putative | proteasome subunit beta type-7, putative | | | 13 | Py17X_13_v3:2,097,334..2,098,146(+) | Py17X_13_v3:2097334..2098146(+) | Py17X_13_v3 | Plasmodium yoelii yoelii 17X | 43 | OG6_101382 | 0 | 270 | 813 | 29809 | 8.10 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1348000ORproteasome subunit beta type-7, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1348000 OR proteasome subunit beta type-7, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1351100 | PY17X_1351100.1 | 2 | 2 | 1 | | | forward | protein coding | No | 555 | PY17X_1351100 | signal peptidase complex catalytic subunit SEC11, putative | signal peptidase complex catalytic subunit SEC11, putative | | | 13 | Py17X_13_v3:2,208,387..2,209,197(+) | Py17X_13_v3:2208387..2209197(+) | Py17X_13_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_100807 | 0 | 184 | 555 | 21046 | 6.88 | 3 | | | GO:0016021;GO:0016020 | integral component of membrane;membrane | GO:0008233;GO:0008236 | peptidase activity;serine-type peptidase activity | GO:0006465 | signal peptide processing | GO:0005783;GO:0005787 | endoplasmic reticulum;signal peptidase complex | | | | | 3.4.21.89 (Signal peptidase I) | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1351100ORsignal peptidase complex catalytic subunit SEC11, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1351100 OR signal peptidase complex catalytic subunit SEC11, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1355900 | PY17X_1355900.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 2820 | PY17X_1355900 | mitochondrial intermediate peptidase, putative | mitochondrial intermediate peptidase, putative | | | 13 | Py17X_13_v3:2,335,206..2,338,201(-) | Py17X_13_v3:2335206..2338201(-) | Py17X_13_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_102110 | 0 | 939 | 2820 | 112121 | 8.39 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | GO:0005739 | mitochondrion | | | | | 3.4.24.59 (Mitochondrial intermediate peptidase) | 3.4.24.59 (Mitochondrial intermediate peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1355900ORmitochondrial intermediate peptidase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1355900 OR mitochondrial intermediate peptidase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1357300 | PY17X_1357300.1 | 8 | 8 | 1 | | | reverse | protein coding | No | 1314 | PY17X_1357300 | SprT-like domain-containing protein, putative | SprT-like domain-containing protein, putative | | | 13 | Py17X_13_v3:2,387,296..2,389,584(-) | Py17X_13_v3:2387296..2389584(-) | Py17X_13_v3 | Plasmodium yoelii yoelii 17X | 45 | OG6_104384 | 0 | 437 | 1314 | 51661 | 9.16 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1357300ORSprT-like domain-containing protein, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1357300 OR SprT-like domain-containing protein, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1363800 | PY17X_1363800.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1596 | PY17X_1363800 | rhomboid protease ROM6, putative | rhomboid protease ROM6, putative | | | 13 | Py17X_13_v3:2,625,197..2,626,792(-) | Py17X_13_v3:2625197..2626792(-) | Py17X_13_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_124366 | 0 | 531 | 1596 | 63406 | 9.96 | 4 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | 3.4.21.105 (Rhomboid protease) | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1363800ORrhomboid protease ROM6, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1363800 OR rhomboid protease ROM6, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1368200 | PY17X_1368200.1 | 2 | 2 | 1 | | | forward | protein coding | No | 729 | PY17X_1368200 | peptidase, putative | peptidase, putative | | | 13 | Py17X_13_v3:2,799,623..2,800,677(+) | Py17X_13_v3:2799623..2800677(+) | Py17X_13_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_110253 | 0 | 242 | 729 | 27599 | 7.92 | 4 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1368200ORpeptidase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1368200 OR peptidase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1371600 | PY17X_1371600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1482 | PY17X_1371600 | lysophospholipase, putative | lysophospholipase, putative | | | 13 | Py17X_13_v3:2,915,192..2,916,673(-) | Py17X_13_v3:2915192..2916673(-) | Py17X_13_v3 | Plasmodium yoelii yoelii 17X | 450 | OG6_100231 | 11 | 493 | 1482 | 57866 | 4.37 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1371600ORlysophospholipase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1371600 OR lysophospholipase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1405800 | PY17X_1405800.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 993 | PY17X_1405800 | site-2 protease S2P, putative | site-2 protease S2P, putative | | | 14 | Py17X_14_v3:340,199..341,328(-) | Py17X_14_v3:340199..341328(-) | Py17X_14_v3 | Plasmodium yoelii yoelii 17X | 43 | OG6_107106 | 0 | 330 | 993 | 38894 | 7.22 | 8 | | | | | | | | | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1405800ORsite-2 protease S2P, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1405800 OR site-2 protease S2P, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1406600 | PY17X_1406600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1182 | PY17X_1406600 | 26S protease regulatory subunit 10B, putative | 26S protease regulatory subunit 10B, putative | | | 14 | Py17X_14_v3:364,110..365,291(-) | Py17X_14_v3:364110..365291(-) | Py17X_14_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_101751 | 0 | 393 | 1182 | 44734 | 9.23 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0008540 | proteasome regulatory particle, base subcomplex | | | GO:0070682;GO:0006511 | proteasome regulatory particle assembly;ubiquitin-dependent protein catabolic process | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1406600OR26S protease regulatory subunit 10B, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1406600 OR 26S protease regulatory subunit 10B, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1411800 | PY17X_1411800.1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1263 | PY17X_1411800 | 26S protease regulatory subunit 7, putative | 26S protease regulatory subunit 7, putative | | | 14 | Py17X_14_v3:539,462..541,035(-) | Py17X_14_v3:539462..541035(-) | Py17X_14_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_101899 | 0 | 420 | 1263 | 46803 | 6.67 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1411800OR26S protease regulatory subunit 7, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1411800 OR 26S protease regulatory subunit 7, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1412100 | PY17X_1412100.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3195 | PY17X_1412100 | M1-family alanyl aminopeptidase, putative | M1-family alanyl aminopeptidase, putative | | | 14 | Py17X_14_v3:548,420..551,614(+) | Py17X_14_v3:548420..551614(+) | Py17X_14_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_106799 | 0 | 1064 | 3195 | 123106 | 6.41 | 1 | HMM: MVTKKLLSFNLFLIIILTF, NN: MVTKKLLSFNLFLIIILTFENLTFDK | NN Sum: 2, NN D: .58, HMM Prob: .62 | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | | 3.4.11.2 (Membrane alanyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1412100ORM1-family alanyl aminopeptidase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1412100 OR M1-family alanyl aminopeptidase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1417200 | PY17X_1417200.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1923 | PY17X_1417200 | U4/U6.U5 tri-snRNP-associated protein 2, putative | U4/U6.U5 tri-snRNP-associated protein 2, putative | | | 14 | Py17X_14_v3:736,493..738,415(+) | Py17X_14_v3:736493..738415(+) | Py17X_14_v3 | Plasmodium yoelii yoelii 17X | 45 | OG6_102786 | 0 | 640 | 1923 | 74030 | 8.19 | 0 | | | | | GO:0036459;GO:0008270 | thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579 | protein deubiquitination | | | | | GO:0000398;GO:0000245 | mRNA splicing, via spliceosome;spliceosomal complex assembly | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1417200ORU4/U6.U5 tri-snRNP-associated protein 2, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1417200 OR U4/U6.U5 tri-snRNP-associated protein 2, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1419300 | PY17X_1419300.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2211 | PY17X_1419300 | ubiquitin carboxyl-terminal hydrolase MINDY, putative | ubiquitin carboxyl-terminal hydrolase MINDY, putative | | | 14 | Py17X_14_v3:814,874..817,084(+) | Py17X_14_v3:814874..817084(+) | Py17X_14_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_102202 | 0 | 736 | 2211 | 85507 | 8.54 | 0 | | | | | GO:1990380;GO:0004843 | Lys48-specific deubiquitinase activity;thiol-dependent ubiquitin-specific protease activity | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1419300ORubiquitin carboxyl-terminal hydrolase MINDY, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1419300 OR ubiquitin carboxyl-terminal hydrolase MINDY, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1420400 | PY17X_1420400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 987 | PY17X_1420400 | microsomal signal peptidase, putative | microsomal signal peptidase, putative | | | 14 | Py17X_14_v3:858,062..859,048(-) | Py17X_14_v3:858062..859048(-) | Py17X_14_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_100609 | 0 | 328 | 987 | 39306 | 10.25 | 2 | | | GO:0016021;GO:0016020 | integral component of membrane;membrane | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1420400ORmicrosomal signal peptidase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1420400 OR microsomal signal peptidase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1427300 | PY17X_1427300.1 | 12 | 12 | 1 | | | forward | protein coding | No | 1416 | PY17X_1427300 | trypsin-like serine protease, putative | trypsin-like serine protease, putative | | | 14 | Py17X_14_v3:1,084,080..1,087,270(+) | Py17X_14_v3:1084080..1087270(+) | Py17X_14_v3 | Plasmodium yoelii yoelii 17X | 39 | OG6_100391 | 0 | 471 | 1416 | 54418 | 9.48 | 1 | | | | | GO:0005515;GO:0004252 | protein binding;serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.107 (Peptidase Do) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1427300ORtrypsin-like serine protease, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1427300 OR trypsin-like serine protease, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1427400 | PY17X_1427400.1 | 5 | 5 | 1 | | | forward | protein coding | No | 876 | PY17X_1427400 | GTP-binding protein YihA3, putative | GTP-binding protein YihA3, putative | | | 14 | Py17X_14_v3:1,087,326..1,088,915(+) | Py17X_14_v3:1087326..1088915(+) | Py17X_14_v3 | Plasmodium yoelii yoelii 17X | 131 | OG6_101142 | 2 | 291 | 876 | 34141 | 10.04 | 1 | HMM: MLNAKTSKIYCILFILFLYINTILTW, NN: MLNAKTSKIYCILFILFLYINTILTW | NN Sum: 4, NN D: .73, HMM Prob: .36 | | | GO:0005525 | GTP binding | | | GO:0020011;GO:0005829 | apicoplast;cytosol | GO:0003924;GO:0043022 | GTPase activity;ribosome binding | | | | 3.6.5.1 (Heterotrimeric G-protein GTPase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1427400ORGTP-binding protein YihA3, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1427400 OR GTP-binding protein YihA3, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1429900 | PY17X_1429900.1 | 1 | 1 | 1 | | | forward | protein coding | No | 16545 | PY17X_1429900 | peptidase family C50, putative | peptidase family C50, putative | | | 14 | Py17X_14_v3:1,187,996..1,204,540(+) | Py17X_14_v3:1187996..1204540(+) | Py17X_14_v3 | Plasmodium yoelii yoelii 17X | 10 | OG6_103054 | 0 | 5514 | 16545 | 657267 | 9.27 | 7 | | | | | GO:0008233 | peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.49 (Separase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1429900ORpeptidase family C50, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1429900 OR peptidase family C50, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1435900 | PY17X_1435900.1 | 3 | 3 | 1 | | | forward | protein coding | No | 1236 | PY17X_1435900 | PPPDE peptidase domain-containing protein, putative | PPPDE peptidase domain-containing protein, putative | | | 14 | Py17X_14_v3:1,369,272..1,370,909(+) | Py17X_14_v3:1369272..1370909(+) | Py17X_14_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_102579 | 0 | 411 | 1236 | 47644 | 5.78 | 1 | | | | | | | | | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1435900ORPPPDE peptidase domain-containing protein, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1435900 OR PPPDE peptidase domain-containing protein, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1444100 | PY17X_1444100.1 | 6 | 6 | 1 | | | forward | protein coding | No | 1155 | PY17X_1444100 | ataxin-3, putative | ataxin-3, putative | | | 14 | Py17X_14_v3:1,703,114..1,705,014(+) | Py17X_14_v3:1703114..1705014(+) | Py17X_14_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_104644 | 0 | 384 | 1155 | 45092 | 6.52 | 0 | | | | | GO:0005515;GO:0004843 | protein binding;thiol-dependent ubiquitin-specific protease activity | GO:0016579 | protein deubiquitination | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1444100ORataxin-3, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1444100 OR ataxin-3, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1447600 | PY17X_1447600.1 | 5 | 5 | 1 | | | reverse | protein coding | No | 624 | PY17X_1447600 | ATP-dependent protease subunit ClpQ, putative | ATP-dependent protease subunit ClpQ, putative | | | 14 | Py17X_14_v3:1,868,139..1,869,296(-) | Py17X_14_v3:1868139..1869296(-) | Py17X_14_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_107204 | 0 | 207 | 624 | 22907 | 8.48 | 0 | | | GO:0009376;GO:0005839 | HslUV protease complex;proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0006508;GO:0051603 | proteolysis;proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.2 (HslU--HslV peptidase) | 3.4.25.2 (HslU--HslV peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1447600ORATP-dependent protease subunit ClpQ, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1447600 OR ATP-dependent protease subunit ClpQ, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1451000 | PY17X_1451000.1 | 3 | 3 | 1 | | | forward | protein coding | No | 3162 | PY17X_1451000 | sentrin-specific protease 1, putative | sentrin-specific protease 1, putative | | | 14 | Py17X_14_v3:2,010,771..2,014,263(+) | Py17X_14_v3:2010771..2014263(+) | Py17X_14_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_101235 | 0 | 1053 | 3162 | 123996 | 7.30 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.68 (Ulp1 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1451000ORsentrin-specific protease 1, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1451000 OR sentrin-specific protease 1, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1451500 | PY17X_1451500.1 | 6 | 6 | 1 | | | reverse | protein coding | No | 1785 | PY17X_1451500 | microgamete surface protein MiGS | microgamete surface protein MiGS | | | 14 | Py17X_14_v3:2,037,370..2,039,801(-) | Py17X_14_v3:2037370..2039801(-) | Py17X_14_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_127652 | 0 | 594 | 1785 | 66636 | 5.04 | 1 | NN: MSQKYLVIVHCVFLLLNLFKTNCY, HMM: MSQKYLVIVHCVFLLLNLFKTNCY | NN Sum: 4, NN D: .81, HMM Prob: .93 | | | | | | | GO:0009986;GO:0044310 | cell surface;osmiophilic body | | | GO:0044007 | dissemination or transmission of symbiont from host | | 3.4.23.3 (Gastricsin) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1451500ORmicrogamete surface protein MiGSANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1451500 OR microgamete surface protein MiGS AND Plasmodium yoelii yoelii 17X |
|
PY17X_1456600 | PY17X_1456600.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2589 | PY17X_1456600 | ATP-dependent zinc metalloprotease FTSH 1, putative | ATP-dependent zinc metalloprotease FTSH 1, putative | | | 14 | Py17X_14_v3:2,224,591..2,227,179(+) | Py17X_14_v3:2224591..2227179(+) | Py17X_14_v3 | Plasmodium yoelii yoelii 17X | 91 | OG6_100384 | 1 | 862 | 2589 | 98372 | 7.55 | 1 | | | GO:0016020 | membrane | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | GO:0020011;GO:0005739 | apicoplast;mitochondrion | GO:0005524;GO:0004176;GO:0004222 | ATP binding;ATP-dependent peptidase activity;metalloendopeptidase activity | GO:0006508;GO:0042493 | proteolysis;response to drug | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1456600ORATP-dependent zinc metalloprotease FTSH 1, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1456600 OR ATP-dependent zinc metalloprotease FTSH 1, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1456900 | PY17X_1456900.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1560 | PY17X_1456900 | 3-hydroxyisobutyryl-CoA hydrolase, putative | 3-hydroxyisobutyryl-CoA hydrolase, putative | | | 14 | Py17X_14_v3:2,252,009..2,253,568(+) | Py17X_14_v3:2252009..2253568(+) | Py17X_14_v3 | Plasmodium yoelii yoelii 17X | 49 | OG6_102025 | 0 | 519 | 1560 | 61164 | 8.86 | 0 | | | | | GO:0003860 | 3-hydroxyisobutyryl-CoA hydrolase activity | | | | | | | | | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1456900OR3-hydroxyisobutyryl-CoA hydrolase, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1456900 OR 3-hydroxyisobutyryl-CoA hydrolase, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1463300 | PY17X_1463300.1 | 8 | 8 | 1 | | | forward | protein coding | No | 1686 | PY17X_1463300 | dipeptidyl aminopeptidase 2, putative | dipeptidyl aminopeptidase 2, putative | | | 14 | Py17X_14_v3:2,454,434..2,457,233(+) | Py17X_14_v3:2454434..2457233(+) | Py17X_14_v3 | Plasmodium yoelii yoelii 17X | 90 | OG6_103622 | 1 | 561 | 1686 | 65712 | 8.71 | 1 | NN: MKYVLFYFLIVFLIGLAKGD, HMM: MKYVLFYFLIVFLIGLAKGD | NN Sum: 4, NN D: .92, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0044310 | osmiophilic body | | | | | | 3.4.14.1 (Dipeptidyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1463300ORdipeptidyl aminopeptidase 2, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1463300 OR dipeptidyl aminopeptidase 2, putative AND Plasmodium yoelii yoelii 17X |
|
PY17X_1464400 | PY17X_1464400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1269 | PY17X_1464400 | 26S protease regulatory subunit 8, putative | 26S protease regulatory subunit 8, putative | | | 14 | Py17X_14_v3:2,485,707..2,486,975(-) | Py17X_14_v3:2485707..2486975(-) | Py17X_14_v3 | Plasmodium yoelii yoelii 17X | 44 | OG6_101513 | 0 | 422 | 1269 | 47869 | 7.01 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0008540 | proteasome regulatory particle, base subcomplex | | | GO:0070682;GO:0043161 | proteasome regulatory particle assembly;proteasome-mediated ubiquitin-dependent protein catabolic process | | 3.6.4.3 (Transferred entry: 5.6.1.1) | https://pubmed.ncbi.nlm.nih.gov/?term=PY17X_1464400OR26S protease regulatory subunit 8, putativeANDPlasmodium yoelii yoelii 17X | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=PY17X_1464400 OR 26S protease regulatory subunit 8, putative AND Plasmodium yoelii yoelii 17X |
